HSF1 Polyclonal antibody 16107-1-AP proteintech
$149.00
In stock
SKU
16107-1-AP
| Catalog Number | 16107-1-AP |
| Synonyms | HSF 1, HSTF 1, HSTF1 |
| Host | Rabbit |
| Reactivity | human, mouse and More (1) |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF, ELISA |
| Applications | WB, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | K-562 cells, HepG2 cells, mouse kidney tissue, mouse spleen tissue, mouse testis tissue, MCF-7 cells |
| Tested Applications — Positive IHC detected in | human cervical cancer tissue, human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:8000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Positive WB detected in | K-562 cells, HepG2 cells, mouse kidney tissue, mouse spleen tissue, mouse testis tissue, MCF-7 cells |
| Positive IHC detected in | human cervical cancer tissue, human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag9023 Product name: Recombinant human HSF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 184-529 aa of BC014638 Sequence: KVVNKLIQFLISLVQSNRILGVKRKIPLMLNDSGSAHSMPKYSRQFSLEHVHGSGPYSAPSPAYSSSSLYAPDAVASSGPIISDITELAPASPMASPGGSIDERPLSSSPLVRVKEEPPSPPQSPRVEEASPGRPSSVDTLLSPTALIDSILRESEPAPASVTALTDARGHTDTEGRPPSPPPTSTPEKCLSVACLDKNELSDHLDAMDSNLDNLQTMLSSHGFSVDTSALLDLFSPSVTVPDMSLPDLDSSLASIQELLSPQEPPRPPEAENSSPDSGKQLVHYTAQPLFLLDPGSVDTGSNDLPVLFELGEGSYFSEGDGFAEDPTISLLTGSEPPKAKDPTVS Predict reactive species |
| Full Name | heat shock transcription factor 1 |
| Calculated Molecular Weight | 529 aa, 57 kDa |
| Observed Molecular Weight | 68-80 kDa |
| GenBank Accession Number | BC014638 |
| Gene Symbol | HSF1 |
| Gene ID (NCBI) | 3297 |
| RRID | AB_11182610 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q00613 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for HSF1 antibody 16107-1-AP | Download protocol |
| WB protocol for HSF1 antibody 16107-1-AP | Download protocol |
| human | WB,IHC Toxicol In Vitro Ginsenoside Rg3 induces FUT4-mediated apoptosis in H. pylori CagA-treated gastric cancer cells by regulating SP1 and HSF1 expressions. Authors - Faisal Aziz View Article |
| rat | WB Pharm Biol Aspirin relieves the calcification of aortic smooth muscle cells by enhancing the heat shock response. Authors - Quanquan Shen View Article |
| Citations | 17 |
| Dilutions | WB : 1:1000-1:8000 IHC : 1:200-1:800 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
HSF1 belongs to heat-shock transcription factors that activate heat-shock response genes under conditions of heat or other stresses. Also, HSF1 has been linked with oogenesis, spermatogenesis, and placental development. It can activate AKT and inactivate JNK and CASP3 to protect cardiomyocytes from death. And it has a role in the regulation of life span and establishes a role for SIRT1 in protein homeostasis and heat-shock response. The calculated molecular weight of HSF1 is 57 kDa, but HSF1 migrates at approximately 80 kDa which likely represents different phosphorylation states (PMID: 18434628). Protocols Product Specific Protocols IHC protocol for HSF1 antibody 16107-1-AP Download protocol WB protocol for HSF1 antibody 16107-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- RBM45 associates with nuclear stress bodies and forms nuclear inclusions during chronic cellular stress and in neurodegenerative diseases.
Journal: Acta Neuropathol Commun | Authors: Mahlon Collins | Species: human | Application: IF - Cancer associated fibroblasts suppressed ferroptosis in glioblastoma via upregulating lncRNA DLEU1
Journal: Am J Physiol Cell Physiol | Authors: Jie Zhao | Species: human | Application: WB - Upregulation of Nuclear Heat Shock Factor 1 Contributes to Tumor Angiogenesis and Poor Survival in Patients With Non-Small Cell Lung Cancer.
Journal: Ann Thorac Surg | Authors: Jingjing Cui | Species: human | Application: IHC - The Capsid Protein VP1 of Coxsackievirus B Induces Cell Cycle Arrest by Up-Regulating Heat Shock Protein 70.
Journal: Front Microbiol | Authors: Yao Wang | Species: human | Application: WB - Aspirin relieves the calcification of aortic smooth muscle cells by enhancing the heat shock response.
Journal: Pharm Biol | Authors: Quanquan Shen | Species: rat | Application: WB - Ginsenoside Rg3 induces FUT4-mediated apoptosis in H. pylori CagA-treated gastric cancer cells by regulating SP1 and HSF1 expressions.
Journal: Toxicol In Vitro | Authors: Faisal Aziz | Species: human | Application: WB,IHC
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
