FAK Polyclonal antibody 12636-1-AP proteintech
$149.00
In stock
SKU
12636-1-AP
| Catalog Number | 12636-1-AP |
| Synonyms | PTK2, EC:2.7.10.2, FADK 1, FAK1, Focal adhesion kinase 1 |
| Host | Rabbit |
| Reactivity | human, mouse, rat and More (2) |
| Reactivity | human, mouse, rat, monkey, chicken |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, IP, CoIP, ELISA |
| Applications | WB, IHC, IF/ICC, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | A431 cells, C6 cells, HEK-293 cells, HUVEC cells, HeLa cells, Jurkat cells, MCF-7 cells, NIH/3T3 cells |
| Tested Applications — Positive IP detected in | HeLa cells |
| Tested Applications — Positive IHC detected in | Hepatocellular carcinoma tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HUVEC cells, A549 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:20000-1:100000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:300-1:1200 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| Positive WB detected in | A431 cells, C6 cells, HEK-293 cells, HUVEC cells, HeLa cells, Jurkat cells, MCF-7 cells, NIH/3T3 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | Hepatocellular carcinoma tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HUVEC cells, A549 cells |
| Western Blot (WB) | WB : 1:20000-1:100000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:300-1:1200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, monkey, chicken |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag3331 Product name: Recombinant human FAK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 381-678 aa of BC028733 Sequence: ITAMAGSIYPGQASLLDQTDSWNHRPQEIAMWQPNVEDSTVLDLRGIGQVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLSRGSIDREDGSLQGPIGNQHIYQPVGKPDPAAPPKKPPRPGAPGHLGSLASLSSPADSYNEGVKLKPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQTR Predict reactive species |
| Full Name | PTK2 protein tyrosine kinase 2 |
| Calculated Molecular Weight | 1052 aa, 119 kDa |
| Observed Molecular Weight | 110 kDa |
| GenBank Accession Number | BC028733 |
| Gene Symbol | FAK |
| Gene ID (NCBI) | 5747 |
| RRID | AB_2173668 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q05397 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for FAK antibody 12636-1-AP | Download protocol |
| IHC protocol for FAK antibody 12636-1-AP | Download protocol |
| IP protocol for FAK antibody 12636-1-AP | Download protocol |
| WB protocol for FAK antibody 12636-1-AP | Download protocol |
| human | WB Oncogene Circadian regulator NR1D2 regulates glioblastoma cell proliferation and motility. Authors - Min Yu View Article |
| mouse | WB J Hazard Mater Polystyrene microplastics induced male reproductive toxicity in mice. Authors - Haibo Jin View Article |
| Nathalie (Verified Customer) (07-12-2022) | Good for ImmunoHistochemistry Applications: Immunohistochemistry Primary Antibody Dilution: 1/50 Cell Tissue Type: Human Skin |
| Citations | 152 |
| Dilutions | WB : 1:20000-1:100000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:300-1:1200 IF/ICC : 1:400-1:1600 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
FAK (Focal adhesion kinase 1) is also named as FAK1, FADK, pp125FAK, FAK and belongs to the protein kinase superfamily. It is a critical tyrosine kinase that modulates cell adhesion, migration, proliferation and survival in response to extracellular signals (PMID:19664602). It also acts as a pivotal signal 'integrator', controlling and coordinating cellular responses that include cell migration, survival, proliferation and, epithelial tissue repair after DNA damage (PMID:20966971). This protein has some isoforms produced by alternative promoter usage and alternative splicing, and the range of the molecular weights are 100-120kD and 40-60kD. Protocols Product Specific Protocols IF protocol for FAK antibody 12636-1-AP Download protocol IHC protocol for FAK antibody 12636-1-AP Download protocol IP protocol for FAK antibody 12636-1-AP Download protocol WB protocol for FAK antibody 12636-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Gain of miR-151 on chromosome 8q24.3 facilitates tumour cell migration and spreading through downregulating RhoGDIA.
Journal: Nat Cell Biol | Authors: Ding Jie J | Species: human | Application: WB - A Spatiotemporal Controllable Biomimetic Skin for Accelerating Wound Repair
Journal: Small | Authors: Yuewei Chen | Species: human | Application: IF - ACTN1 promotes HNSCC tumorigenesis and cisplatin resistance by enhancing MYH9-dependent degradation of GSK-3β and integrin β1-mediated phosphorylation of FAK
Journal: J Exp Clin Cancer Res | Authors: Li Cui | Species: human | Application: WB - Polystyrene microplastics induced male reproductive toxicity in mice.
Journal: J Hazard Mater | Authors: Haibo Jin | Species: mouse | Application: WB - Mechanotransduction in response to ECM stiffening impairs cGAS immune signaling in tumor cells
Journal: Cell Rep | Authors: Yingqi Liu | Species: human | Application: WB - Circadian regulator NR1D2 regulates glioblastoma cell proliferation and motility.
Journal: Oncogene | Authors: Min Yu | Species: human | Application: WB - Exosome-derived lnc-FAM72D-3 promotes lenvatinib resistance by remodeling hepatocellular carcinoma cytoskeleton via MBNL1/FAK axis
Journal: Drug Resist Updat | Authors: Mingbo Cao | Species: human | Application: WB,IP,IF - Eukaryote initiation factor 6 modulates small-cell lung carcinoma plasticity via the integrin-FAK signaling axis.
Journal: Nat Commun | Authors: Haoning Peng | Species: mouse,human | Application: WB - Galectin-3-integrin α5β1 phase separation disrupted by advanced glycation end-products impairs diabetic wound healing in rodents.
Journal: Nat Commun | Authors: Zhongyu Zhang | Species: rat,mouse,human | Application: WB - Molecular landscape, subtypes, and therapeutic vulnerabilities of central nervous system solitary fibrous tumors
Journal: Nat Commun | Authors: Chenhui Zhao | Application: WB - Graphene Oxide Induced Perturbation to Plasma Membrane and Cytoskeletal Meshwork Sensitize Cancer Cells to Chemotherapeutic Agents
Journal: ACS Nano | Authors: Jianqiang Zhu | Species: mouse,human | Application: WB - Targeting TFAM K76 acetylation attenuates mitochondrial dysfunction and kidney injury in diabetic kidney disease.
Journal: Cardiovasc Diabetol | Authors: Tingting Fu | Species: mouse,human | Application: WB,IP,IHC,IF - Investigation of nanotopography on SOCE mediated cell migration via live-cell : Imaging on opaque implant surface
Journal: J Nanobiotechnology | Authors: Yan Zhang | Species: mouse | Application: IF - Stanniocalcin 1 promotes metastasis, lipid metabolism and cisplatin chemoresistance via the FOXC2/ITGB6 signaling axis in ovarian cancer.
Journal: J Exp Clin Cancer Res | Authors: Feikai Lin | Species: human | Application: WB - ACTN1 promotes HNSCC tumorigenesis and cisplatin resistance by enhancing MYH9-dependent degradation of GSK-3β and integrin β1-mediated phosphorylation of FAK
Journal: J Exp Clin Cancer Res | Authors: Li Cui | Species: human | Application: WB - OCIAD2 Stabilizes Integrin β1 Signaling Through SNX17-Mediated Endosomal Recycling to Lipid Rafts and Modulates Cisplatin Response in HNSCC.
Journal: Adv Sci (Weinh) | Authors: Li Cui | Species: human | Application: WB - Biological Reinforced Concrete for Cartilage Repair With 3D Printing
Journal: Adv Sci (Weinh) | Authors: Yuewei Chen | Species: human | Application: IF - 2'3'-cGAMP interactome identifies 2'3'-cGAMP/Rab18/FosB signaling in cell migration control independent of innate immunity
Journal: Sci Adv | Authors: Yu Deng | Species: human | Application: WB - LDH nanoparticles-doped cellulose nanofiber scaffolds with aligned microchannels direct high-efficiency neural regeneration and organized neural circuit remodeling through RhoA/Rock/Myosin II pathway
Journal: Biomaterials | Authors: Xuening Pang | Species: mouse | Application: WB - Stiffness assisted cell-matrix remodeling trigger 3D mechanotransduction regulatory programs
Journal: Biomaterials | Authors: Anna L Kersey | Species: human | Application: WB - Multi-omics factor analysis identifies the Tensin 1-Fermitin family homologue 2-Fibronectin 1-Integrin signaling axis as a prognostic determinant in colorectal cancer.
Journal: Mol Biomed | Authors: Tianwei Chen | Species: mouse,human | Application: WB - LINC00941 promotes pancreatic cancer malignancy by interacting with ANXA2 and suppressing NEDD4L-mediated degradation of ANXA2
Journal: Cell Death Dis | Authors: Jie Wang | Species: human | Application: WB - BK ablation attenuates osteoblast bone formation via integrin pathway.
Journal: Cell Death Dis | Authors: Yinhang Wang | Species: mouse | Application: WB - Long non-coding RNA MALAT1 promotes gastric cancer tumorigenicity and metastasis by regulating vasculogenic mimicry and angiogenesis.
Journal: Cancer Lett | Authors: Yue Li | Species: human | Application: WB - A Spatiotemporal Controllable Biomimetic Skin for Accelerating Wound Repair
Journal: Small | Authors: Yuewei Chen | Species: human | Application: IF - Hypoxia-driven TNS4 fosters HNSCC tumorigenesis by stabilizing integrin α5β1 complex and triggering FAK-mediated Akt and TGFβ signaling pathways
Journal: Int J Biol Sci | Authors: Xinyuan Zhao | Species: human | Application: WB - Targeting the hydrophobic pockets of FAK/PYK2 FAT domain: a highly effective inhibitory strategy suppressing tumor growth and eliminating metastasis
Journal: Cell Commun Signal | Authors: Maria Christoforou | Species: human | Application: IF - The EPRS-ATF4-COLI pathway axis is a potential target for anaplastic thyroid carcinoma therapy
Journal: Phytomedicine | Authors: Li Mi | Species: mouse,human | Application: WB - Putative molecular determinants mediating sensitivity or resistance towards carnosic acid tumor cell responses.
Journal: Phytomedicine | Authors: Nuha Mahmoud | Species: human | Application: WB - Hepatic cavernous hemangioma decellularized extracellular matrix/GelMA composite hydrogel promotes angiogenesis via the ITGA9-FAK-ERK1/2 axis.
Journal: Mater Today Bio | Authors: Zongbo Dai | Species: human | Application: WB - Polystyrene microplastics induced male reproductive toxicity in mice.
Journal: J Hazard Mater | Authors: Haibo Jin | Species: mouse | Application: WB - Spatial Dimension Cues Derived From Fibrous Scaffolds Trigger Mechanical Activation to Potentiate the Paracrine and Regenerative Functions of MSCs via the FAK-PI3K/AKT Axis
Journal: Acta Biomater | Authors: Shixin Xu | Application: WB - Shape-Fixing Hydrogel Promotes Scarless Healing of Wounds Under Tension
Journal: Acta Biomater | Authors: Danlan Fu | Species: mouse | Application: IF - A novel chemical inhibitor suppresses breast cancer cell growth and metastasis through inhibiting HPIP oncoprotein.
Journal: Cell Death Discov | Authors: Pengyun Li | Species: human | Application: WB - A scaffold-free, collagen-guided self-assembling adipose construct for functional soft tissue reconstruction.
Journal: Acta Biomater | Authors: Yuchen Zhang - Circadian regulator NR1D2 regulates glioblastoma cell proliferation and motility.
Journal: Oncogene | Authors: Min Yu | Species: human | Application: WB - Focal adhesion kinase antisense oligodeoxynucleotides inhibit human pulmonary artery smooth muscle cells proliferation and promote human pulmonary artery smooth muscle cells apoptosis.
Journal: Chin Med J (Engl) | Authors: Lin Chun-long CL | Species: human | Application: WB - Circadian regulator NR1D2 regulates glioblastoma cell proliferation and motility.
Journal: Oncogene | Authors: Min Yu | Species: human | Application: WB - Rotating magnetic field downregulating type XI collagen to suppress triple-negative breast cancer metastasis by inactivating the ITGB1/FAK/YAP signaling pathway.
Journal: Int J Biol Macromol | Authors: Tongyao Yu | Species: human | Application: WB - Laminin β1 stimulates the Hippo-YAP1 pathway to advance the progression and lenvatinib resistance in hepatocellular carcinoma.
Journal: Int J Biol Macromol | Authors: Zhiliang Cai | Species: human | Application: WB - Peptide deregulated in hypertrophic scar-1 alleviates hypertrophic scar fibrosis by targeting focal adhesion kinase and pyruvate kinase M2 and remodeling the metabolic landscape
Journal: Int J Biol Macromol | Authors: Jingyun Li | Species: human | Application: WB - SphK1 modulates cell migration and EMT-related marker expression by regulating the expression of p-FAK in colorectal cancer cells.
Journal: Int J Mol Med | Authors: Chun-Yan Xu - Novel tissue mechanics-guided cellular flows drive the formation of feather follicles.
Journal: EMBO J | Authors: Hans I-Chen Harn | Species: chicken | Application: IHC - Targeting DUSP26 to drive cardiac mitochondrial dynamics via FAK-ERK signaling in diabetic cardiomyopathy
Journal: Free Radic Biol Med | Authors: Chong Liu | Species: rat,mouse | Application: WB - Genetic dependencies associated with transcription factor activities in human cancer cell lines
Journal: Cell Rep | Authors: Venu Thatikonda - Mechanotransduction in response to ECM stiffening impairs cGAS immune signaling in tumor cells
Journal: Cell Rep | Authors: Yingqi Liu | Species: human | Application: WB - Cystathionine‑γ‑lyase promotes the metastasis of breast cancer via the VEGF signaling pathway.
Journal: Int J Oncol | Authors: Lupeng Wang | Species: human | Application: WB - Sphingosine kinase 1 promotes the metastasis of colorectal cancer by inducing the epithelial‑mesenchymal transition mediated by the FAK/AKT/MMPs axis.
Journal: Int J Oncol | Authors: Shi-Quan Liu | Species: human | Application: WB,IHC - Cyclic Heptapeptide FZ1 Acts as an Integrin αvβ3 Agonist to Facilitate Diabetic Skin Wound Healing by Enhancing Angiogenesis.
Journal: J Med Chem | Authors: Litian Wang | Species: mouse,human | Application: WB - Pan-cancer analysis predict that FAT1 is a therapeutic target and immunotherapy biomarker for multiple cancer types including non-small cell lung cancer
Journal: Front Immunol | Authors: Chen Ding | Species: mouse,human | Application: WB,IHC - miR-484 sensitizes in IDH-wild and IDH-mutant glioblastoma cells to temozolomide by inhibiting oncogenic FOXM1 signaling.
Journal: Cancer Cell Int | Authors: Nursultan Nurdinov | Species: human | Application: WB - TRIM15 Mediates ubiquitination of Paxillin to facilitate the progression of ovarian cancer.
Journal: Cancer Cell Int | Authors: Jiaqi Xu - Therapeutic potential of isochlorogenic acid A from Taraxacum officinale in improving immune response and enhancing the efficacy of PD-1/PD-L1 blockade in triple-negative breast cancer
Journal: Front Immunol | Authors: Tangyi Wang | Species: mouse,human | Application: WB - Matrix Stiffening Enhances DNCB-Induced IL-6 Secretion in Keratinocytes Through Activation of ERK and PI3K/Akt Pathway.
Journal: Front Immunol | Authors: Hyewon Chung | Species: human | Application: IF - Jiawei Buzhong Yiqi decoction ameliorates polycystic ovary syndrome via oocyte-granulosa cell communication
Journal: J Ethnopharmacol | Authors: Runan Hu | Species: rat | Application: WB,IF - Discovery of a potent anticancer agent against pancreatic ductal adenocarcinoma targeting FAK with DFG-out state and JAK/Aurora kinases
Journal: Eur J Med Chem | Authors: Rong-Hong Zhang | Species: human | Application: WB - Superhydrophilic and topography-regulatable surface grafting on PEEK to improve cellular affinity
Journal: Biomater Adv | Authors: Bowen Zhang | Species: human | Application: WB - Design, synthesis, and biological evaluation of 2,4-diamino pyrimidine derivatives as potent FAK inhibitors with anti-cancer and anti-angiogenesis activities.
Journal: Eur J Med Chem | Authors: Shan Wang | Species: human | Application: WB - TC2N maintains stem cell-like characteristics to accelerate lung carcinogenesis by blockade of dual specificity protein phosphatase 3
Journal: Cell Biosci | Authors: Jing Gu | Species: mouse,Human | Application: WB - From stem cells to skin: ADSCP6 peptide's role in transforming scar therapy
Journal: Biochem Pharmacol | Authors: Jun Li | Species: mouse | Application: WB - Design and screening of a novel neuropilin-1 targeted penetrating peptide for anti-angiogenic therapy in glioma.
Journal: Life Sci | Authors: Lin Zhao | Species: human | Application: WB - Carnosol mitigates Ang II-stimulated vascular injury and oxidative stress by directly binding to FAK and inhibiting its activation
Journal: Inflammopharmacology | Authors: Yucheng Jiang | Species: mouse,human | Application: WB - Filamin C Deficiency Impairs Sarcomere Stability and Activates Focal Adhesion Kinase through PDGFRA Signaling in Induced Pluripotent Stem Cell-Derived Cardiomyocytes
Journal: Cells | Authors: Shanshan Gao | Species: human | Application: WB,IF - Response of Human Gingival Fibroblasts and Porphyromonas gingivalis to UVC-Activated Titanium Surfaces
Journal: J Funct Biomater | Authors: Yin Wen | Species: human | Application: IF - Mg-Fe layered double hydroxides modified titanium enhanced the adhesion of human gingival fibroblasts through regulation of local pH level.
Journal: Mater Sci Eng C Mater Biol Appl | Authors: Yijia Yin | Species: human | Application: WB - 2-Methoxy-5((3,4,5-trimethosyphenyl)seleninyl) phenol reverses EGF-induced cell migration and invasion through down-regulation of MDM2 in breast cancer cell lines.
Journal: Cancer Biol Ther | Authors: Dayong Zheng | Species: human | Application: WB - Equine β-defensin 1 regulates cytokine expression and phagocytosis in S. aureus-infected mouse monocyte macrophages via the Paxillin-FAK-PI3K pathway
Journal: Int Immunopharmacol | Authors: Le Pei | Species: human | Application: WB - Proximity Labeling to Identify β-Arrestin1 Binding Partners Downstream of Ligand-Activated G Protein-Coupled Receptors
Journal: Int J Mol Sci | Authors: Ya Zhuo | Species: monkey,human | Application: WB - Focal adhesion kinase induces cardiac remodeling through NF-κB-mediated inflammatory responses in diabetic cardiomyopathy
Journal: Int Immunopharmacol | Authors: Bo Jin | Species: rat - Gut microbial metabolite, sphingosine-1-phosphate (S1P), drives mesangial cell phenotypic transformation and accelerates progression of IgA nephropathy via CCL2-MET-FAK pathway.
Journal: Curr Res Microb Sci | Authors: Yu-yan Tang | Species: mouse,human | Application: IF - rRGD3(mu), a Triple-RGD Recombinant Peptide, Suppresses Malignant Phenotypes in Nasopharyngeal Carcinoma-Associated Models Through the Modulation of ITGB1-Associated FAK/AKT Signaling.
Journal: Int J Mol Sci | Authors: Qianhui Yuan | Species: human | Application: WB - A Novel Blood-Brain Barrier-Penetrating and Vascular-Targeting Chimeric Peptide Inhibits Glioma Angiogenesis
Journal: Int J Mol Sci | Authors: Lu Lu | Species: human | Application: WB - Proximity Labeling to Identify β-Arrestin1 Binding Partners Downstream of Ligand-Activated G Protein-Coupled Receptors
Journal: Int J Mol Sci | Authors: Ya Zhuo | Species: monkey,human | Application: WB - Gut microbial metabolite, sphingosine-1-phosphate (S1P), drives mesangial cell phenotypic transformation and accelerates progression of IgA nephropathy via CCL2-MET-FAK pathway.
Journal: Curr Res Microb Sci | Authors: Yu-yan Tang | Species: mouse,human | Application: IF - Focal adhesion kinase induces cardiac remodeling through NF-κB-mediated inflammatory responses in diabetic cardiomyopathy
Journal: Int Immunopharmacol | Authors: Bo Jin | Species: rat - Essential Role of Sptan1 in Cochlear Hair Cell Morphology and Function Via Focal Adhesion Signaling.
Journal: Mol Neurobiol | Authors: Qingxiu Yao | Species: mouse | Application: IF - Dioscin Inhibits HSC-T6 Cell Migration via Adjusting SDC-4 Expression: Insights from iTRAQ-Based Quantitative Proteomics.
Journal: Front Pharmacol | Authors: Lianhong Yin | Species: rat | Application: WB - HMGA2 upregulation mediates Cd-induced migration and invasion in A549 cells and in lung tissues of mice.
Journal: Chem Biol Interact | Authors: Huiyuan Luo | Species: human | Application: WB - HMGA2 upregulation mediates Cd-induced migration and invasion in A549 cells and in lung tissues of mice.
Journal: Chem Biol Interact | Authors: Huiyuan Luo | Species: human | Application: WB - Photoaging of polystyrene microspheres causes oxidative alterations to surface physicochemistry and enhances airway epithelial toxicity
Journal: Toxicol Sci | Authors: Eliane El Hayek | Species: human | Application: IF - Indoloquinazoline alkaloids suppress angiogenesis and inhibit metastasis of melanoma cells
Journal: Bioorg Chem | Authors: Xingchen Guo | Species: human | Application: WB - A novel FAK-targeted degrader: Design, synthesis, and therapeutic potential against colorectal cancer.
Journal: Bioorg Chem | Authors: Yong-Jun Li | Species: human | Application: WB - Deficiency in augmenter of liver regeneration accelerates liver fibrosis by promoting migration of hepatic stellate cell.
Journal: Biochim Biophys Acta Mol Basis Dis | Authors: Wei-Lun Ai - The apical ciliary adhesion complex is established at the basal foot of motile cilia and depends on the microtubule network
Journal: Sci Rep | Authors: Maria Chatzifrangkeskou | Application: WB,IF - The apical ciliary adhesion complex is established at the basal foot of motile cilia and depends on the microtubule network
Journal: Sci Rep | Authors: Maria Chatzifrangkeskou | Application: WB,IF - The Mammalian Target of Rapamycin and DNA methyltransferase 1 axis mediates vascular endothelial dysfunction in response to disturbed flow.
Journal: Sci Rep | Authors: Yun-Peng Zhang | Species: human | Application: WB - ADCY4 inhibits cAMP-induced growth of breast cancer by inactivating FAK/AKT and ERK signaling but is frequently silenced by DNA methylation.
Journal: Sci Rep | Authors: Guangrui Pan | Species: human | Application: WB - BACH1 promotes lung adenocarcinoma cell metastasis through transcriptional activation of ITGA2
Journal: Cancer Sci | Authors: Yingji Chen | Application: WB - Brucein D suppresses breast cancer proliferation and migration via targeting the FAK/LRG1 signaling pathway.
Journal: Sci Rep | Authors: Lin Li | Species: human | Application: WB,IHC,IF - Quantitative profiling of spreading-coupled protein tyrosine phosphorylation in migratory cells.
Journal: Sci Rep | Authors: Yajun Xie | Species: human | Application: WB - The brain imaging feature-related gene NRP2 drives the malignant progression of glioblastoma through the FAK pathway: a Mendelian randomization study.
Journal: Transl Oncol | Authors: Yang Li | Species: human | Application: WB,IP - Quantitative profiling of spreading-coupled protein tyrosine phosphorylation in migratory cells.
Journal: Sci Rep | Authors: Yajun Xie | Species: human | Application: WB - Surface changes of nanotopography by carbon ion implantation to enhance the biocompatibility of silicone rubber: an in vitro study of the optimum ion fluence and adsorbed protein.
Journal: J Mater Sci Mater Med | Authors: Xianhui Li | Species: human | Application: WB - DLC-1 induces mitochondrial apoptosis and epithelial mesenchymal transition arrest in nasopharyngeal carcinoma by targeting EGFR/Akt/NF-κB pathway.
Journal: Med Oncol | Authors: Wei Huang | Species: human | Application: WB - Effects of stable knockdown of Aurora kinase A on proliferation, migration, chromosomal instability, and expression of focal adhesion kinase and matrix metalloproteinase-2 in HEp-2 cells.
Journal: Mol Cell Biochem | Authors: Zhang Hao H | Species: mouse | Application: WB,IHC - WTX-L/β-arrestin2/LCN2 axis controls vulnerability to ferroptosis in gastric cancer
Journal: iScience | Authors: Yangwei Xu | Species: human | Application: WB - WTX-L/β-arrestin2/LCN2 axis controls vulnerability to ferroptosis in gastric cancer
Journal: iScience | Authors: Yangwei Xu | Species: human | Application: WB - Mechanisms of HIV-mediated blood-brain barrier compromise and leukocyte transmigration under the current antiretroviral era
Journal: iScience | Authors: Cristian Hernandez | Species: human | Application: WB - Activation of Autophagy Induces Monocrotaline-Induced Pulmonary Arterial Hypertension by FOXM1-Mediated FAK Phosphorylation
Journal: Lung | Authors: Cui Zhai | Species: rat | Application: WB - Angiopoietin-2 regulates the phenotypic switch of vascular smooth muscle cells
Journal: FASEB J | Authors: Xiaowen Gan | Species: human | Application: WB - Puerarin Promotes the Migration and Differentiation of Myoblasts by Activating the FAK and PI3K/AKT Signaling Pathways
Journal: Biology (Basel) | Authors: Xiaofeng Fang | Species: mouse | Application: WB - Regulation of integrin α5β1-mediated Staphylococcus aureus cellular invasion by the septin cytoskeleton
Journal: Eur J Cell Biol | Authors: Stevens Robertin | Species: human | Application: WB - Functional analysis reveals that Tinagl1 is required for normal muscle development in mice through the activation of ERK signaling.
Journal: Biochim Biophys Acta Mol Cell Res | Authors: Yoriko Sato | Species: mouse,human | Application: WB - FAK mediates hypoxia-induced pulmonary artery smooth muscle cell proliferation by modulating mitochondrial transcription termination factor 1/cyclin D1
Journal: Clin Transl Sci | Authors: Chunlong Lin | Species: human | Application: WB,IF - Silencing ZIC2 abrogates tumorigenesis and anoikis resistance of non-small cell lung cancer cells by inhibiting Src/FAK signaling.
Journal: Mol Ther Oncolytics | Authors: Aibin Liu | Species: human | Application: WB - β-arrestin1 and signal-transducing adaptor molecule 1 (STAM1) cooperate to promote focal adhesion kinase autophosphorylation and chemotaxis via the chemokine receptor CXCR4.
Journal: J Biol Chem | Authors: Olga Alekhina | Species: human | Application: WB - RhoB regulates prostate cancer cell proliferation and docetaxel sensitivity via the PI3K-AKT signaling pathway
Journal: BMC Cancer | Authors: Tiantian Sheng | Species: human | Application: WB - A non-GPCR-binding partner interacts with a novel surface on β-arrestin1 to mediate GPCR signaling.
Journal: J Biol Chem | Authors: Ya Zhuo | Species: human | Application: WB - Avian Hepatitis E Virus ORF2 Protein Interacts with Rap1b to Induce Cytoskeleton Rearrangement That Facilitates Virus Internalization.
Journal: Microbiol Spectr | Authors: Beibei Zhang | Species: chicken | Application: WB - A non-GPCR-binding partner interacts with a novel surface on β-arrestin1 to mediate GPCR signaling.
Journal: J Biol Chem | Authors: Ya Zhuo | Species: human | Application: WB - Elucidating the PTK2-Targeted Anti-Hepatocellular Carcinoma Effects of Euphorbia helioscopia L. via Integrated Network Pharmacology, Mendelian Randomization, and Experimental Validation.
Journal: Curr Issues Mol Biol | Authors: Jianhua Zhu | Species: mouse | Application: WB - YY1 regulates the proliferation and invasion of triple-negative breast cancer via activating PLAUR
Journal: Funct Integr Genomics | Authors: Chao Zhang | Species: mouse,human | Application: WB - CSNK2B contributes to colorectal cancer cell proliferation by activating the mTOR signaling.
Journal: J Cell Commun Signal | Authors: Shijun Yu | Species: human | Application: WB - Photoaffinity Probe Reveals the Potential Target of Harringtonolide for Cancer Cell Migration Inhibition
Journal: ACS Med Chem Lett | Authors: Tian-Yu Zhu | Species: human | Application: WB,CoIP - Photoaffinity Probe Reveals the Potential Target of Harringtonolide for Cancer Cell Migration Inhibition
Journal: ACS Med Chem Lett | Authors: Tian-Yu Zhu | Species: human | Application: WB,CoIP - Inhibition of THBS1 axis contributes to the antitumor effect of PA-MSHA in anaplastic thyroid cancer
Journal: Exp Cell Res | Authors: Zhe Li | Species: human | Application: WB - Scaffold hopping-directed design and discovery of N1-substituted aminopyrimidine-indole derivatives as FAK inhibitors with anti-pancreatic cancer activity.
Journal: Bioorg Med Chem | Authors: Libo Cai - RELM-β promotes human pulmonary artery smooth muscle cell proliferation via FAK-stimulated surviving.
Journal: Exp Cell Res | Authors: Chunlong Lin | Species: human | Application: WB - Shepherdin Affects the Biological Behavior of Rhabdomyosarcoma and Enhances its X-Ray Sensitivity.
Journal: Appl Biochem Biotechnol | Authors: Li Niu - Potential effect of matrix stiffness on the enrichment of tumor initiating cells under three-dimensional culture conditions.
Journal: Exp Cell Res | Authors: Chang Liu | Species: rat | Application: WB - Integrin β6 mediates epithelial-mesenchymal transition in diabetic kidney disease
Journal: Mol Cell Endocrinol | Authors: Xiaoyu Li | Species: mouse | Application: WB - N2E4, a Monoclonal Antibody Targeting Neuropilin-2, Inhibits Tumor Growth and Metastasis in Pancreatic Ductal Adenocarcinoma via Suppressing FAK/Erk/HIF-1α Signaling.
Journal: Front Oncol | Authors: Li Wang | Species: human | Application: WB - Mesoderm/mesenchyme homeobox gene l promotes vascular smooth muscle cell phenotypic modulation and vascular remodeling.
Journal: Int J Cardiol | Authors: Bing Wu | Species: rat | Application: WB - Integrin β4 Regulates Cell Migration of Lung Adenocarcinoma Through FAK Signaling
Journal: Mol Biotechnol | Authors: Shusen Zhang | Species: human | Application: WB,CoIP - Tinagl1 restores tamoxifen sensitivity and blocks fibronectin-induced EMT by simultaneously blocking the EGFR and β1-integrin/FAK signaling pathways in tamoxifen-resistant breast cancer cells
Journal: IUBMB Life | Authors: Jie Yuan | Species: human | Application: WB - Dioscin, a potent ITGA5 inhibitor, reduces the synthesis of collagen against liver fibrosis: Insights from SILAC-based proteomics analysis.
Journal: Food Chem Toxicol | Authors: Lina Xu | Species: human | Application: WB - The small protein LINC01547-ORF inhibits colorectal cancer progression by regulating the CLDN18-FAK-AKT axis
Journal: Am J Cancer Res | Authors: Shuai Zhang | Species: human | Application: WB - Alpha-Enolase Protects Hepatocyte Against Heat Stress Through Focal Adhesion Kinase-Mediated Phosphatidylinositol 3-Kinase/Akt Pathway.
Journal: Front Genet | Authors: Tao Zeng | Species: chicken | Application: WB - Arene ruthenium(ii) complex, a potent inhibitor against proliferation, migration and invasion of breast cancer cells, reduces stress fibers, focal adhesions and invadopodia.
Journal: Metallomics | Authors: Qiong Wu | Species: human | Application: WB - CircRNA_0017076 acts as a sponge for miR-185-5p in the control of epithelial-to-mesenchymal transition of tubular epithelial cells during renal interstitial fibrosis
Journal: Hum Cell | Authors: Fan Zhang | Species: human | Application: WB - FAK downregulation suppresses stem-like properties and migration of human colorectal cancer cells
Journal: PLoS One | Authors: Chunyan Xu | Species: human | Application: WB,CoIP - Effects of Kindlin-2 on proliferation and migration of VSMC and integrinβ1 andβ3 activity via FAK-PI3K signaling pathway.
Journal: PLoS One | Authors: Xiaolin Wu | Species: rat | Application: WB - FAK downregulation suppresses stem-like properties and migration of human colorectal cancer cells
Journal: PLoS One | Authors: Chunyan Xu | Species: human | Application: WB,CoIP - PTPRE promotes gastric cancer cell resistance to 5-fluorouracil by inhibiting ferroptosis via the Src/FAK/TRIB3 axis.
Journal: PLoS One | Authors: Ming Liu | Species: human | Application: WB - Croton tiglium essential oil compounds have anti-proliferative and pro-apoptotic effects in A549 lung cancer cell lines.
Journal: PLoS One | Authors: Qing-Lin Niu | Species: human | Application: WB - In Vivo and In Vitro Fibroblasts' Behavior and Capsular Formation in Correlation with Smooth and Textured Silicone Surfaces.
Journal: Aesthetic Plast Surg | Authors: Shu-Qing Huang | Species: human | Application: WB - Syntaphilin inhibits glioma invasion via modulating mitochondria redistribution and shapes the immune microenvironment: A potential prognostic biomarker.
Journal: Gene | Authors: Hui Tian | Species: human | Application: WB - EGFR/FAK and c-Src signaling pathways mediate the internalization of Staphylococcus aureus by osteoblasts.
Journal: Cell Microbiol | Authors: Zhiguo Ji | Species: mouse | Application: WB - Single-cell and bulk transcriptomic analyses reveal ITGA5-driven epithelial-mesenchymal transition and metabolic adaptation in thyroid cancer
Journal: Biochem Biophys Res Commun | Authors: Xiaobo Li | Species: human | Application: WB - Alginate oligosaccharide protects endothelial cells against oxidative stress injury via integrin-α/FAK/PI3K signaling.
Journal: Biotechnol Lett | Authors: Jing Zhao | Species: human | Application: WB - The GLI2/CDH6 axis enhances migration, invasion and mitochondrial fission of stomach adenocarcinoma cells
Journal: Biochem Biophys Res Commun | Authors: Guang-Yi Liu | Species: human | Application: WB - Expression of DCUN1D1 in laryngeal squamous cell carcinoma and its inhibiting effect on TU-177 cells after interfered by RNA.
Journal: Clin Exp Pharmacol Physiol | Authors: Jing Liu | Species: human | Application: WB - LIM domain-containing 2 (LIMD2) promotes the progress of ovarian cancer via the focal adhesion signaling pathway.
Journal: Bioengineered | Authors: Lixin Chen | Species: human | Application: WB - HMGA1 is associated with unfavorable outcome and accelerates the aggressiveness of cholangiocarcinoma.
Journal: SAGE Open Med | Authors: Ratthaphong Phumphu - A monoclonal antibody targeting neuropilin-1 inhibits adhesion of MCF7 breast cancer cells to fibronectin by suppressing the FAK/p130cas signaling pathway.
Journal: Anticancer Drugs | Authors: Fanwei Zeng - Low level lasers effect on proliferation, migration and anti-apoptosis of mesenchymal stem cells.
Journal: Stem Cells Dev | Authors: Kan Yin | Species: mouse | Application: WB - Integrating RNA-seq and Single-Cell RNA-seq to Uncover Transcriptional Signature of Fibroblasts in Oral Squamous Cell Carcinoma.
Journal: Biochem Genet | Authors: Ning Wen | Species: human | Application: WB - GRHL2 suppresses tumor metastasis via regulation of transcriptional activity of RhoG in non-small cell lung cancer.
Journal: Am J Transl Res | Authors: Xiang Pan | Species: human | Application: WB - Multi-omics profiling reveals MAGEL2-driven defects in human corticogenesis shared across Prader-Willi and Schaaf-Yang syndromes.
Journal: bioRxiv | Authors: Jannis Buecking | Species: human | Application: IF - Defective insulin clearance plays a primary role in the pathogenesis of chronic kidney disease in mice with null deletion of Ceacam2 gene.
Journal: bioRxiv | Authors: Sivarajan Kumarasamy | Species: mouse | Application: WB - Multi-omics profiling reveals MAGEL2-driven defects in human corticogenesis shared across Prader-Willi and Schaaf-Yang syndromes.
Journal: bioRxiv | Authors: Jannis Buecking | Species: human | Application: IF - [Protective effect of FAK inhibitor PF-562271 against human umbilical vein endothelial cell injury induced by aging platelets]
Journal: Nan Fang Yi Ke Da Xue Xue Bao | Authors: Y Bai | Species: human | Application: WB,IF - Tumor-derived CTHRC1 mediates ITGB3-dependent osteoclast differentiation to promote prostate cancer bone metastasis.
Journal: Oncogene | Authors: Tao Xie - Integrin α6-targeted photodynamic therapy potentiates PD-1 blockade in MSS colorectal cancer.
Journal: J Nanobiotechnology | Authors: Ting Hu - Integrin αVβ3-mediated focal adhesion signaling promotes fibroblast activation during renal fibrosis.
Journal: Biochem Pharmacol | Authors: Dongdong Wu
Reviews
Write Your Own Review