ICAM-1/CD54 Polyclonal antibody 15364-1-AP proteintech
$149.00
In stock
SKU
15364-1-AP
| Catalog Number | 15364-1-AP |
| Synonyms | CD54, ICAM-1, BB2, ICAM 1, ICAM1 |
| Host | Rabbit |
| Reactivity | human and More (1) |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF, IP, ELISA |
| Applications | WB, IHC, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HUVEC cells, Raji cells, HeLa cells, L02 cells |
| Tested Applications — Positive IP detected in | Raji cells |
| Tested Applications — Positive IHC detected in | human colon cancer tissue, human heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:2000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Positive WB detected in | HUVEC cells, Raji cells, HeLa cells, L02 cells |
| Positive IP detected in | Raji cells |
| Positive IHC detected in | human colon cancer tissue, human heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag8309 Product name: Recombinant human ICAM-1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 181-532 aa of BC015969 Sequence: GANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYEIVIITVVAAAVIMGTAGLSTYLYNRQRKIKKYRLQQAQKGTPMKPNTQATPP Predict reactive species |
| Full Name | intercellular adhesion molecule 1 |
| Calculated Molecular Weight | 90 kDa |
| Observed Molecular Weight | 85-95 kDa |
| GenBank Accession Number | BC015969 |
| Gene Symbol | ICAM-1 |
| Gene ID (NCBI) | 3383 |
| ENSEMBL Gene ID | ENSG00000090339 |
| RRID | AB_2122050 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P05362 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for ICAM-1/CD54 antibody 15364-1-AP | Download protocol |
| IP protocol for ICAM-1/CD54 antibody 15364-1-AP | Download protocol |
| WB protocol for ICAM-1/CD54 antibody 15364-1-AP | Download protocol |
| mouse | WB,IF ACS Nano Antigen Self-Presented Personalized Nanovaccines Boost the Immunotherapy of Highly Invasive and Metastatic Tumors Authors - Tingting Wang View Article |
| human | WB Cell Commun Signal Investigating the therapeutic effects and mechanisms of Carthamus tinctorius L.-derived nanovesicles in atherosclerosis treatment Authors - Rongfeng Yang View Article |
| Citations | 9 |
| Dilutions | WB : 1:500-1:2000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:1000-1:4000 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Where is ICAM-1 expressed? Intercellular Adhesion Molecule 1 (ICAM-1), also known as Cluster of Differentiation 54 (CD54) is a transmembrane glycoprotein constitutively expressed at low levels in endothelial cells, pericytes and on some lymphocytes and monocytes 1 . It is located at the cytoplasmic membrane, with a large extracellular region of mainly hydrophobic amino acids joined to a small transmembrane region and a cytoplasmic tail. It has a molecular weight of 75 to 115 kDa depending on the level of glycosylation. What is the function of ICAM-1? ICAM-1 is important in both innate and adaptive immune responses as an adhesion molecule. Although it is constitutively expressed, in the presence of pro-inflammatory cytokines such as TNFα the endothelial cells are activated and upregulate expression of ICAM-1 2 . In blood vessels lined with endothelial cells, leukocytes that are rolling over the surface are able to bind to ICAM-1 and transmigrate through the endothelial barrier and into the tissue. The initial binding of the leukocytes to ICAM-1 causes a Ca2+ release that initiates endothelial cell contraction and weakening of the intercellular tight junctions 3, 4 . This protein can be used as an indicator of endothelial activation and of vascular inflammation. What is the role of ICAM-1 in disease? Beyond the role in the immune response, ICAM-1 has also been identified as the target of attachment for the human rhinovirus, the cause of the common cold. Binding of the virus to ICAM-1 causes the viral capsid to uncoat and leads to release of the genetic material 5 . Hubbard, A. K. & Rothlein, R. Intercellular adhesion molecule-1 (ICAM-1) expression and cell signaling cascades. Free Radic. Biol. Med. 28, 1379-86 (2000). Long, E. O. ICAM-1: getting a grip on leukocyte adhesion. J. Immunol. 186, 5021-3 (2011). Lawson, C. & Wolf, S. ICAM-1 signaling in endothelial cells. (2009). Lyck, R. & Enzmann, G. The physiological roles of ICAM-1 and ICAM-2 in neutrophil migration into tissues. Curr. Opin. Hematol. 22, 53-59 (2015). Xing, L., Casasnovas, J. M. & Cheng, R. H. Structural analysis of human rhinovirus complexed with ICAM-1 reveals the dynamics of receptor-mediated virus uncoating. J. Virol. 77, 6101-7 (2003). Protocols Product Specific Protocols IHC protocol for ICAM-1/CD54 antibody 15364-1-AP Download protocol IP protocol for ICAM-1/CD54 antibody 15364-1-AP Download protocol WB protocol for ICAM-1/CD54 antibody 15364-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Antigen Self-Presented Personalized Nanovaccines Boost the Immunotherapy of Highly Invasive and Metastatic Tumors
Journal: ACS Nano | Authors: Tingting Wang | Species: mouse | Application: WB,IF - Pulmonary endothelium-targeted nanoassembly of indomethacin and superoxide dismutase relieves lung inflammation
Journal: Acta Pharm Sin B | Authors: Yi Yang | Species: human | Application: IF - Naringin inhibits TNF-α induced oxidative stress and inflammatory response in HUVECs via Nox4/NF-κ B and PI3K/Akt pathways.
Journal: Curr Pharm Biotechnol | Authors: Wenshuang Li | Species: human | Application: WB - Prognostic prediction and diagnostic role of intercellular adhesion molecule-1 (ICAM1) expression in clear cell renal cell carcinoma.
Journal: J Mol Histol | Authors: Xuebing Shi | Species: human | Application: IHC - Sulfhydrated albumin transmits H2S signaling and ameliorates DOX-induced multiorgan injuries
Journal: Redox Biol | Authors: Yijun Xu | Species: human | Application: WB - Investigating the therapeutic effects and mechanisms of Carthamus tinctorius L.-derived nanovesicles in atherosclerosis treatment
Journal: Cell Commun Signal | Authors: Rongfeng Yang | Species: human | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
