Caveolin-1 Polyclonal antibody 16447-1-AP proteintech
$149.00
In stock
SKU
16447-1-AP
| Catalog Number | 16447-1-AP |
| Synonyms | Caveolin 1, CAV1, MSTP085, CGL3, CAV |
| Host | Rabbit |
| Reactivity | human, mouse, rat and More (5) |
| Reactivity | human, mouse, rat, pig, canine, monkey, zebrafish, bovine |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF, IP, CoIP, ELISA |
| Applications | WB, IHC, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | A549 cells, HeLa cells, NIH/3T3 cells |
| Tested Applications — Positive IP detected in | A549 cells |
| Tested Applications — Positive IHC detected in | human breast cancer tissue, human lung tissue, human heart tissue, human liver tissue, human lung cancer tissue, mouse brain tissue, mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:8000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Positive WB detected in | A549 cells, HeLa cells, NIH/3T3 cells |
| Positive IP detected in | A549 cells |
| Positive IHC detected in | human breast cancer tissue, human lung tissue, human heart tissue, human liver tissue, human lung cancer tissue, mouse brain tissue, mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, canine, monkey, zebrafish, bovine |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag8049 Product name: Recombinant human Caveolin-1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 11-179 aa of BC006432 Sequence: GHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI Predict reactive species |
| Full Name | caveolin 1, caveolae protein, 22kDa |
| Calculated Molecular Weight | 22 kDa |
| Observed Molecular Weight | 20-25 kDa |
| GenBank Accession Number | BC006432 |
| Gene Symbol | CAV1 |
| Gene ID (NCBI) | 857 |
| RRID | AB_10732595 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q03135 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for Caveolin-1 antibody 16447-1-AP | Download protocol |
| IP protocol for Caveolin-1 antibody 16447-1-AP | Download protocol |
| WB protocol for Caveolin-1 antibody 16447-1-AP | Download protocol |
| human | IF Small Smart Carbon Nanotubes with Laser-Controlled Behavior in Gene Delivery and Therapy through a Non-Digestive Trafficking Pathway. Authors - Fenfen Kong View Article |
| mouse | WB Biomaterials Combination antitumor immunotherapy with VEGF and PIGF siRNA via systemic delivery of multi-functionalized nanoparticles to tumor-associated macrophages and breast cancer cells. Authors - Yudong Song View Article |
| human,mouse | WB,IF Redox Biol Selenoprotein K contributes to CD36 subcellular trafficking in hepatocytes by accelerating nascent COPII vesicle formation and aggravates hepatic steatosis Authors - Mengyue You View Article |
| Kezhong (Verified Customer) (08-17-2026) | The antibody did not work well for IF application. Low positive signals. Applications: Immunofluorescence Primary Antibody Dilution: 1:50-1:500 for IF or IHC Cell Tissue Type: Human liver tissue; mouse primary hepatocytes |
| Celine (Verified Customer) (02-11-2026) | works well in Western Blot Applications: Western Blot Primary Antibody Dilution: 1/1000 Cell Tissue Type: glioblastoma cells |
| Sammy (Verified Customer) (01-20-2024) | Excellent antibody for use by western blotting. Diluted in 3% BSA PBST. Applications: Western Blot Primary Antibody Dilution: 1 in 1000 Cell Tissue Type: HUVEC Caveolin-1 Antibody Western Blot validation (1 in 1000 dilution) in HUVEC (Cat no:16447-1-AP) |
| Priya (Verified Customer) (06-21-2023) | Used this antibody for Caco2 cells andmice tissue Applications: Western Blot Primary Antibody Dilution: 1 to 1000 Cell Tissue Type: Caco2, Mice colon |
| Priya (Verified Customer) (04-17-2023) | Used for Caco2 cells Applications: Western Blot Primary Antibody Dilution: 1 to 2000 Cell Tissue Type: Caco2, Mice colon |
| Emma (Verified Customer) (03-15-2022) | Works really well @ 1:1000 for WB in PC3 and DU145 cells. Single band seen. Applications: Western Blot Primary Antibody Dilution: 1:1000 Cell Tissue Type: Prostate |
| Kushal (Verified Customer) (08-09-2021) | We tried to use the antibody at high concentrations of 1:100, yet we do not get bands in our blots. Applications: Western Blot Primary Antibody Dilution: 1:100 Cell Tissue Type: Caco-2 |
| Citations | 136 |
| Dilutions | WB : 1:1000-1:8000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Caveolin-1 (CAV1), a multifunctional protein, is the main constituent molecule of caveolae and represents a scaffolding molecule for several signaling molecules including epidermal growth factor receptor (PMID: 19641024). Several studies have implicated that a reduced expression of CAV1 was found in cancers including head and neck carcinoma (PMID: 19002186). However, other studies recognize CAV1 as a tumor promoter because CAV1 is overexpressed in various kinds of cancers, especially in oral cancer (PMID: 20558341). Recent study also show that CAV1 is involved in astric Cancer (PMID: 25339030). MW of Caveolin-1 is from 20-25 kDa due to phosphorylation (PMID: 10198051). Protocols Product Specific Protocols IHC protocol for Caveolin-1 antibody 16447-1-AP Download protocol IP protocol for Caveolin-1 antibody 16447-1-AP Download protocol WB protocol for Caveolin-1 antibody 16447-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- RAB31 marks and controls an ESCRT-independent exosome pathway.
Journal: Cell Res | Authors: Denghui Wei | Species: human | Application: WB - Nucleosomes enter cells by clathrin- and caveolin-dependent endocytosis.
Journal: Nucleic Acids Res | Authors: Huawei Wang | Species: human | Application: WB - Vangl2 limits chaperone-mediated autophagy to balance osteogenic differentiation in mesenchymal stem cells.
Journal: Dev Cell | Authors: Yan Gong | Species: mouse | Application: WB - Selenoprotein K contributes to CD36 subcellular trafficking in hepatocytes by accelerating nascent COPII vesicle formation and aggravates hepatic steatosis
Journal: Redox Biol | Authors: Mengyue You | Species: human,mouse | Application: WB,IF - Combination antitumor immunotherapy with VEGF and PIGF siRNA via systemic delivery of multi-functionalized nanoparticles to tumor-associated macrophages and breast cancer cells.
Journal: Biomaterials | Authors: Yudong Song | Species: mouse | Application: WB - Smart Carbon Nanotubes with Laser-Controlled Behavior in Gene Delivery and Therapy through a Non-Digestive Trafficking Pathway.
Journal: Small | Authors: Fenfen Kong | Species: human | Application: IF - Mapping of endosomal proximity proteomes reveals Retromer as a hub for RAB GTPase regulation
Journal: Nat Commun | Authors: Carlos Antón-Plágaro | Application: WB,IF - IDH2 lactylation promotes angiogenesis in murine diabetic myocardial infarction via blocking Cav1-eNOS interaction.
Journal: Nat Commun | Authors: Guangyao Zang | Species: mouse | Application: WB,IP - Selenoprotein K contributes to CD36 subcellular trafficking in hepatocytes by accelerating nascent COPII vesicle formation and aggravates hepatic steatosis
Journal: Redox Biol | Authors: Mengyue You | Species: human,mouse | Application: WB,IF - Nucleosomes enter cells by clathrin- and caveolin-dependent endocytosis.
Journal: Nucleic Acids Res | Authors: Huawei Wang | Species: human | Application: WB - Tumor Extracellular Vesicles Aggravate Mitochondrial Damage in Myocardial Ischemia/Reperfusion Injury
Journal: Adv Sci (Weinh) | Authors: Zhongting Mei - Unraveling the Role of MDK-SDC4 Interaction in Pancreatic Cancer-Associated New-Onset Diabetes by Single-Cell Transcriptomic Analysis
Journal: Adv Sci (Weinh) | Authors: Zengyu Feng | Species: human | Application: WB - Combination antitumor immunotherapy with VEGF and PIGF siRNA via systemic delivery of multi-functionalized nanoparticles to tumor-associated macrophages and breast cancer cells.
Journal: Biomaterials | Authors: Yudong Song | Species: mouse | Application: WB - Amyloid futures in the expanding pathology of brain aging and dementia
Journal: Alzheimers Dement | Authors: Max A Thorwald | Species: human | Application: WB - Calreticulin promotes EGF-induced EMT in pancreatic cancer cells via Integrin/EGFR-ERK/MAPK signaling pathway.
Journal: Cell Death Dis | Authors: Weiwei Sheng | Species: human | Application: WB - TRPC1 contributes to endotoxemia-induced myocardial dysfunction via mediating myocardial apoptosis and autophagy.
Journal: Pharmacol Res | Authors: Wen Tian - Smart Carbon Nanotubes with Laser-Controlled Behavior in Gene Delivery and Therapy through a Non-Digestive Trafficking Pathway.
Journal: Small | Authors: Fenfen Kong | Species: human | Application: IF - Caveolin-1 negatively regulates the calcitonin receptor-like receptor and neuroinflammation in a female mouse model of migraine
Journal: J Neuroinflammation | Authors: Yanjie Zhou | Species: mouse | Application: WB,IHC - Salvianolic acid B enhances tissue repair and regeneration by regulating immune cell migration and Caveolin-1-mediated blastema formation in zebrafish
Journal: Phytomedicine | Authors: Mengchen Qin | Species: zebrafish | Application: IF - Celastrol triggers CAV-1-mediated mitochondrion cholesterol metabolism and mitophagy to suppress liver cancer.
Journal: Phytomedicine | Authors: Hong-Fang Li | Species: human | Application: WB,IHC - Liquiritin in Aiduqing formula inhibits breast cancer neoangiogenesis by suppressing CTSK-mediated lysosomal degradation of CXCL1 in tumor-associated macrophages.
Journal: Phytomedicine | Authors: Bowen Yang | Species: human | Application: WB - Modified Fuzheng Yiliu Decoction chemosensitizes colorectal cancer by inhibiting cancer stem cell metabolism and stemness through CAV1/ZNF460/GRP78 signaling.
Journal: Phytomedicine | Authors: Yuling Xue | Species: human,mouse | Application: WB,IF,CoIP - Qingqi Liangying formula inhibits brain endothelial cell pyroptosis via NLRP3/caspase-1/GSDMD in sepsis-associated encephalopathy.
Journal: Phytomedicine | Authors: Siyu Song | Species: mouse | Application: WB,IHC - Cardioprotective effects of polydatin against myocardial injury in HFD/stz and high glucose-induced diabetes via a Caveolin 1-dependent mechanism
Journal: Phytomedicine | Authors: Wenyan Gong | Species: mouse,rat | Application: WB - Qingqi Liangying formula inhibits brain endothelial cell pyroptosis via NLRP3/caspase-1/GSDMD in sepsis-associated encephalopathy.
Journal: Phytomedicine | Authors: Siyu Song | Species: mouse | Application: WB,IHC - Celastrol triggers CAV-1-mediated mitochondrion cholesterol metabolism and mitophagy to suppress liver cancer.
Journal: Phytomedicine | Authors: Hong-Fang Li | Species: human | Application: WB,IHC - POH1 contributes to hyperactivation of TGF-β signaling and facilitates hepatocellular carcinoma metastasis through deubiquitinating TGF-β receptors and caveolin-1.
Journal: EBioMedicine | Authors: Boshi Wang | Species: human | Application: WB - Ultrasound-Guided Functionalized Extracellular Vesicles for Visualized, Controlled, and Efficient Renal Delivery for Enhanced Kidney Repair
Journal: Adv Healthc Mater | Authors: Yuhao Chen | Species: human | Application: IF - Exogenous H2S initiating Nrf2/GPx4/GSH pathway through promoting Syvn1-Keap1 interaction in diabetic hearts
Journal: Cell Death Discov | Authors: Mengyi Wang | Species: mouse | Application: WB - Disc regeneration by injectable fucoidan-methacrylated dextran hydrogels through mechanical transduction and macrophage immunomodulation
Journal: J Tissue Eng | Authors: Weifeng Li | Species: human | Application: IF,WB - Quinic acid regulated TMA/TMAO-related lipid metabolism and vascular endothelial function through gut microbiota to inhibit atherosclerotic
Journal: J Transl Med | Authors: Qiao Jin | Species: mouse | Application: WB - Exogenous H2S Induces Hrd1 S-sulfhydration and Prevents CD36 Translocation via VAMP3 Ubiquitylation in Diabetic Hearts.
Journal: Aging Dis | Authors: Miao Yu | Species: mouse | Application: WB - Vangl2 limits chaperone-mediated autophagy to balance osteogenic differentiation in mesenchymal stem cells.
Journal: Dev Cell | Authors: Yan Gong | Species: mouse | Application: WB - A cholesterol-dependent LRRC8A-caveolin-1 axis sustains KRAS/EGFR signaling, ribosome biogenesis and growth in pancreatic ductal adenocarcinoma.
Journal: Oncogene | Authors: Qing Ye | Species: human | Application: WB - Inflammatory Cell-Derived MYDGF Attenuates Endothelial LDL Transcytosis to Protect Against Atherogenesis
Journal: Arterioscler Thromb Vasc Biol | Authors: Jinling Xu | Species: human,mouse | Application: IHC,IF - Binding of Hypoxia-Induced Mitogenic Factor/RELM-β to Bone Morphogenetic Protein Receptor 2 Complex Promotes Pulmonary Hypertension.
Journal: Arterioscler Thromb Vasc Biol | Authors: Ting Zhang | Species: rat | Application: WB - Scavenger receptor a mediates glycated LDL transcytosis across endothelial cells to promote atherosclerosis
Journal: Int J Biol Macromol | Authors: Wenzhuo Cheng | Species: human | Application: WB - Activation of sigma 1 receptor attenuates doxorubicin-induced cardiotoxicity by alleviating oxidative stress, mitochondria dysfunction, ER stress-related apoptosis, and autophagy impairment
Journal: Int J Biol Macromol | Authors: Ahmed Al-Maamari | Species: mouse | Application: WB - Dihydroartemisinin inhibits the viability of cervical cancer cells by upregulating caveolin 1 and mitochondrial carrier homolog 2: Involvement of p53 activation and NAD(P)H:quinone oxidoreductase 1 downregulation.
Journal: Int J Mol Med | Authors: Ting Zhang | Species: human | Application: WB - The protective effect of harpagoside on angiotensin II (Ang II)-induced blood-brain barrier leakage in vitro.
Journal: Phytother Res | Authors: Yun Wei Lu | Species: mouse | Application: WB - Caveolin-1 alleviates acetaminophen-induced vascular oxidative stress and inflammation in non-alcoholic fatty liver disease
Journal: Free Radic Biol Med | Authors: Dongdong Fu | Species: human,mouse | Application: WB - Smooth muscle NR4A3 upregulation caused by endothelial Caveolin-1 deficiency mediates vascular remodeling and pulmonary hypertension.
Journal: Free Radic Biol Med | Authors: Jing Huang | Species: mouse | Application: WB,IF - Smooth muscle NR4A3 upregulation caused by endothelial Caveolin-1 deficiency mediates vascular remodeling and pulmonary hypertension.
Journal: Free Radic Biol Med | Authors: Jing Huang | Species: mouse | Application: WB,IF - Puerarin Reduces Blood Pressure in Spontaneously Hypertensive Rats by Targeting eNOS.
Journal: Am J Chin Med | Authors: Weili Shi | Species: rat | Application: WB - An orally available hypoglycaemic peptide taken up by caveolae transcytosis displays improved hypoglycaemic effects and body weight control in db/db mice.
Journal: Br J Pharmacol | Authors: Weisheng Lu | Species: human | Application: IF - Cardioprotective and anti-inflammatory effects of Caveolin 1 in experimental diabetic cardiomyopathy
Journal: Clin Sci (Lond) | Authors: Wenyan Gong | Species: mouse,rat | Application: WB,IF - Simvastatin Downregulates the SARS-CoV-2-Induced Inflammatory Response and Impairs Viral Infection Through Disruption of Lipid Rafts.
Journal: Front Immunol | Authors: Lívia Teixeira | Species: human | Application: WB - CAV1 promotes epithelial-to-mesenchymal transition (EMT) and chronic renal allograft interstitial fibrosis by activating the ferroptosis pathway
Journal: Front Immunol | Authors: Qianguang Han | Species: human,mouse | Application: IHC,IF - ANGPTL2+cancer-associated fibroblasts and SPP1+macrophages are metastasis accelerators of colorectal cancer
Journal: Front Immunol | Authors: Xiangxiang Liu | Species: human | Application: IHC - Bovine coronavirus enters PBIECs via membrane fusion and clathrin-, caveolin-mediated endocytosis, macropinocytosis.
Journal: Virulence | Authors: Chen Chen | Species: bovine | Application: IF - Erzhi Pill promotes norepinephrine synthesis in locus coeruleus through ERβ-TFAP2A-TH plays a neuroprotective role
Journal: J Ethnopharmacol | Authors: Ao Xue | Species: mouse | Application: WB - Dahuang Zhechong pill attenuates hepatic sinusoidal capillarization in liver cirrhosis and hepatocellular carcinoma rat model via MK/integrin signaling pathway
Journal: J Ethnopharmacol | Authors: Chuankui Fu | Species: rat | Application: WB - Betulinic acid suppresses breast cancer aerobic glycolysis via caveolin-1/NF-κB/c-Myc pathway.
Journal: Biochem Pharmacol | Authors: Lin Jiao | Species: human | Application: WB,IHC - Irisin alleviates steroid-induced vascular dysfunction by regulating the αVβ5-c-Abl-Caveolin-1 signaling pathway
Journal: Biochem Pharmacol | Authors: Lijun Fang | Species: human,mouse | Application: WB - Betulinic acid suppresses breast cancer aerobic glycolysis via caveolin-1/NF-κB/c-Myc pathway.
Journal: Biochem Pharmacol | Authors: Lin Jiao | Species: human | Application: WB,IHC - Flavin adenine dinucleotide ameliorates hypertensive vascular remodeling via activating short chain acyl-CoA dehydrogenase.
Journal: Life Sci | Authors: Xiaoyi Zhong | Species: human | Application: WB - Metformin Inhibits Propofol-Induced Apoptosis of Mouse Hippocampal Neurons HT-22 Through Downregulating Cav-1.
Journal: Drug Des Devel Ther | Authors: Jianyun Ge | Species: mouse | Application: WB - Mechanisms of dihydromyricetin against hepatocellular carcinoma elucidated by network pharmacology combined with experimental validation
Journal: Pharm Biol | Authors: Shuo Zhang | Species: human | Application: WB - Catalpol relieved angiotensin II-induced blood–brain barrier destruction via inhibiting the TLR4 pathway in brain endothelial cells
Journal: Pharm Biol | Authors: Yu Xia | Species: mouse | Application: WB - Hypoxic tubular epithelial cells regulate the angiogenesis of HMEC-1 cells via mediation of Rab7/MMP-2 axis.
Journal: Aging (Albany NY) | Authors: Yiqiong Yang | Species: human | Application: WB - Oligoarginine-Bearing Tandem Repeat Penetration-Accelerating Sequence Delivers Protein to Cytosol via Caveolae-Mediated Endocytosis.
Journal: Biomacromolecules | Authors: Akiko Okuda | Species: human | Application: WB,IF - Huafengdan Inhibits Glioblastoma Cell Growth and Mobility by Acting on PLAU and CAV1 Targets
Journal: Pharmaceuticals (Basel) | Authors: Dengxiao Lin - The new anti-angiogenesis perspective of rheumatoid arthritis with geniposide: Reducing the extracellular release of HSP70 in HUVECs
Journal: Int Immunopharmacol | Authors: Yi Wei | Species: human | Application: WB,IF,CoIP - Prognostic Value of CAV1 and CAV2 in Head and Neck Squamous Cell Carcinoma
Journal: Biomolecules | Authors: Jingyu He | Species: human | Application: IHC - Tripartite motif 16 mitigates endotoxemia-induced cardiac dysfunction via the Cav-1/Src/YAP signaling axis in mice.
Journal: Int Immunopharmacol | Authors: Bing Han - Modulation of Actin Filament Dynamics by Inward Rectifying of Potassium Channel Kir2.1.
Journal: Int J Mol Sci | Authors: Lida Wu | Species: human | Application: WB - Tripartite motif 16 mitigates endotoxemia-induced cardiac dysfunction via the Cav-1/Src/YAP signaling axis in mice.
Journal: Int Immunopharmacol | Authors: Bing Han - Prognostic Value of CAV1 and CAV2 in Head and Neck Squamous Cell Carcinoma
Journal: Biomolecules | Authors: Jingyu He | Species: human | Application: IHC - Caveolin-1 Alleviates Acetaminophen-Induced Hepatotoxicity in Alcoholic Fatty Liver Disease by Regulating the Ang II/EGFR/ERK Axis
Journal: Int J Mol Sci | Authors: Jiao Xin | Species: human,mouse | Application: WB - The new anti-angiogenesis perspective of rheumatoid arthritis with geniposide: Reducing the extracellular release of HSP70 in HUVECs
Journal: Int Immunopharmacol | Authors: Yi Wei | Species: human | Application: WB,IF,CoIP - Modulation of Actin Filament Dynamics by Inward Rectifying of Potassium Channel Kir2.1.
Journal: Int J Mol Sci | Authors: Lida Wu | Species: human | Application: WB - Klotho antagonizes pulmonary fibrosis through suppressing pulmonary fibroblasts activation, migration, and extracellular matrix production: a therapeutic implication for idiopathic pulmonary fibrosis.
Journal: Aging (Albany NY) | Authors: Qiqing Huang | Species: mouse | Application: WB,IF - m6A-mediated upregulation of LINC01003 regulates cell migration by targeting the CAV1/FAK signaling pathway in glioma
Journal: Biol Direct | Authors: Xiaolong Zhu | Species: human | Application: WB - Sanguisorba officinalis L. Suppresses Triple-Negative Breast Cancer Metastasis by Inhibiting Late-Phase Autophagy via Hif-1α/Caveolin-1 Signaling.
Journal: Front Pharmacol | Authors: Neng Wang | Species: human,zebrafish | Application: WB,IHC - O-GlcNAcylation of eNOS in high-salt-induced thoracic aorta endothelial dysfunction in mice.
Journal: Front Pharmacol | Authors: Chang Li | Species: mouse | Application: WB - Crosstalk Between RPE Cells and Choroidal Endothelial Cells via the ANXA1/FPR2/SHP2/NLRP3 Inflammasome/Pyroptosis Axis Promotes Choroidal Neovascularization.
Journal: Inflammation | Authors: Manhui Zhu | Species: human | Application: WB - Dynamic Dissection of the Endocytosis of Porcine Epidemic Diarrhea Coronavirus Cooperatively Mediated by Clathrin and Caveolae as Visualized by Single-Virus Tracking
Journal: mBio | Authors: Yangyang Li | Species: monkey | Application: IF - Autophagic Inhibition of Caveolin-1 by Compound Phyllanthus urinaria L. Activates Ubiquitination and Proteasome Degradation of β-catenin to Suppress Metastasis of Hepatitis B-Associated Hepatocellular Carcinoma.
Journal: Front Pharmacol | Authors: Danping Huang | Species: human | Application: WB - Ajuba receptor mediates the internalization of tumor-secreted GRP78 into macrophages through different endocytosis pathways.
Journal: Oncotarget | Authors: Xiaoqin La | Species: human | Application: IF - TGFBR-IDH1-Cav1 axis promotes TGF-β signalling in cancer-associated fibroblast.
Journal: Oncotarget | Authors: Xiaodan Hou | Species: human | Application: WB - A targeted multi-proteomics approach generates a blueprint of the ciliary ubiquitinome
Journal: Front Cell Dev Biol | Authors: Mariam G Aslanyan | Species: human | Application: IF - Caveolin-1 and its functional peptide CSP7 affect silica-induced pulmonary fibrosis by regulating fibroblast glutaminolysis
Journal: Toxicol Sci | Authors: Guanru Li | Species: mouse,human | Application: WB - miR‑96 exerts an oncogenic role in the progression of cervical cancer by targeting CAV‑1.
Journal: Mol Med Rep | Authors: Yong Chen | Species: human | Application: WB - Effects of autophagy and endocytosis on the activity of matrix metalloproteinase‑2 in human renal proximal tubular cells under hypoxia.
Journal: Mol Med Rep | Authors: Wenmin Yu | Species: Human - Effects of autophagy and endocytosis on the activity of matrix metalloproteinase‑2 in human renal proximal tubular cells under hypoxia.
Journal: Mol Med Rep | Authors: Wenmin Yu | Species: Human - Over-expression of microRNA-1 causes arrhythmia by disturbing intracellular trafficking system.
Journal: Sci Rep | Authors: Xiaomin Su | Species: mouse | Application: WB - Abnormal ac4C modification in metabolic dysfunction associated steatotic liver cells
Journal: Sci Rep | Authors: Xiqian Zhang | Species: human | Application: WB - MCL1 promotes porcine epidemic diarrhea virus replication by modulating arachidonic acid metabolic pathway.
Journal: PLoS Pathog | Authors: Hongqi Shang | Species: pig | Application: WB,IF - Anti-NMDAR antibody exposure induces cognitive inflexibility and prefrontal GABAergic dysregulation in mice.
Journal: Exp Neurol | Authors: Zhixin Wu | Species: mouse | Application: WB - Irisin alters D-galactose-induced apoptosis by increasing caveolin-1 expression in C2C12 myoblasts and skeletal muscle fibroblasts
Journal: Mol Cell Biochem | Authors: Yaoxuan Wu | Species: mouse | Application: WB - Identification of AXL as a novel positive regulator of lipid raft in gastric cancer
Journal: Cell Signal | Authors: Zhi Yang | Species: human | Application: WB,IF,CoIP - Low-intensity pulsed ultrasound attenuates cardiac inflammation of CVB3-induced viral myocarditis via regulation of caveolin-1 and MAPK pathways.
Journal: J Cell Mol Med | Authors: Cheng Zheng | Species: mouse | Application: WB - Cytoplasmic domain and enzymatic activity of ACE2 are not required for PI4KB dependent endocytosis entry of SARS-CoV-2 into host cells.
Journal: Virol Sin | Authors: Hang Yang | Species: human | Application: WB - The protective effects of hyperoside on Ang II-mediated apoptosis of bEnd.3 cells and injury of blood-brain barrier model in vitro.
Journal: BMC Complement Med Ther | Authors: Yu Yan Xie | Species: mouse | Application: WB - Lipid raft interacting galectin 8 regulates primary ciliogenesis
Journal: FASEB J | Authors: Jhan-Jhang Syu | Species: canine | Application: WB,IP,IF - Tumoral microvesicle-activated glycometabolic reprogramming in fibroblasts promotes the progression of oral squamous cell carcinoma.
Journal: FASEB J | Authors: Erhui Jiang | Species: human | Application: WB,IHC - Lipid raft interacting galectin 8 regulates primary ciliogenesis
Journal: FASEB J | Authors: Jhan-Jhang Syu | Species: canine | Application: WB,IP,IF - ICAM-1-mediated Src signaling pathway plays a pivotal role in encephalomyocarditis virus entry
Journal: J Virol | Authors: Ruiya Lian - A proteomic signature and potential pharmacological opportunities in the adaptive resistance to MEK and PI3K kinase inhibition in pancreatic cancer cells
Journal: Proteomics | Authors: Alain Aguilar-Valdés | Species: human | Application: WB - Caveolin-1 expression predicts efficacy of weekly nab-paclitaxel plus gemcitabine for metastatic breast cancer in the phase II clinical trial.
Journal: BMC Cancer | Authors: Yannan Zhao | Species: human | Application: IHC - Role of epithelial sodium channels (ENaCs) in endothelial function.
Journal: J Cell Sci | Authors: Dongqing Guo | Species: human | Application: WB - Obesity induced caveolin-1 impairs osteogenesis via activating mitophagy and inhibiting Sirt1 signaling
Journal: Bone | Authors: Shuai Liu | Species: mouse | Application: WB - Identification of CAV1 and DCN as potential predictive biomarkers for lung adenocarcinoma.
Journal: Am J Physiol Lung Cell Mol Physiol | Authors: Yuanliang Yan | Application: IHC - Caveolin-1 protects against liver injury and lipid accumulation in alcoholic fatty liver via ferroptosis resistance
Journal: Mol Immunol | Authors: Weiju Xue | Species: mouse | Application: WB,IHC - Midkine mediates dysfunction of liver sinusoidal endothelial cells through integrin α4 and α6
Journal: Vascul Pharmacol | Authors: Li Wu | Species: rat | Application: WB,IF - 3,4-Dimethoxycinnamic acid from coffee silverskin biowaste ameliorates bleomycin-induced pulmonary fibrosis via modulating caveolin-1-dependent activation of NF-κB, TGF-β1/Smad3, and ERK1/2 signaling pathways
Journal: Toxicol Appl Pharmacol | Authors: Mahmoud Elshal | Species: rat | Application: WB - Retrospective Cohort Study of Caveolin-1 Expression as Prognostic Factor in Unresectable Locally Advanced or Metastatic Pancreatic Cancer Patients
Journal: Curr Oncol | Authors: Alessandro Bittoni | Species: human | Application: IHC - Docosahexaenoic acid alters Gsα localization in lipid raft and potentiates adenylate cyclase.
Journal: Nutrition | Authors: Zhuoran Zhu | Species: mouse | Application: WB - Caveolin-1 suppresses hippocampal neuron apoptosis via the regulation of HIF1α in hypoxia in naked mole-rats
Journal: Cell Biol Int | Authors: Wenjing Yang | Species: mouse,rat | Application: WB,IF,IHC - Histone MARylation regulates lipid metabolism in colorectal cancer by promoting IGFBP1 methylation
Journal: Exp Cell Res | Authors: Chuanling Wang | Species: human | Application: WB - Network-pharmacology-based identification of caveolin-1 as a key target of Oldenlandia diffusa to suppress breast cancer metastasis.
Journal: Biomed Pharmacother | Authors: Bowen Yang | Species: human | Application: WB,IF,IHC - Caveolin-1 promotes radioresistance via IRGM-regulated autophagy in lung cancer.
Journal: Ann Transl Med | Authors: Xi Chen | Species: human | Application: WB - α-Hemolysin suppresses osteogenesis by inducing lipid rafts accumulation in bone marrow stromal cells.
Journal: Food Chem Toxicol | Authors: Guanqiao Liu | Species: mouse | Application: WB,IHC - Quantitative proteomic analysis of scleras in guinea pig exposed to wavelength defocus.
Journal: J Proteomics | Authors: Yingying Wen | Application: WB - Quantitative proteomic analysis of scleras in guinea pig exposed to wavelength defocus.
Journal: J Proteomics | Authors: Yingying Wen | Application: WB - Aberrant miR199a-5p/ Caveolin1/ PPARα axis in hepatic steatosis.
Journal: J Mol Endocrinol | Authors: Bo Li | Application: WB - Exosomal miR-552-3p isolated from BALF of patients with silicosis induces fibroblast activation
Journal: Toxicol Lett | Authors: Mengyu Li | Species: mouse | Application: WB - Prognostic and immunological roles of ammonia-induced cell death-related genes in non-small cell lung cancer.
Journal: BMC Pulm Med | Authors: Hongbin Li | Species: human | Application: WB - ZhuYang TongBi decoction ameliorates pulmonary fibrosis by degrading TGFBR via CAV1.
Journal: Fitoterapia | Authors: Jing Wang - Daidzein alleviates osteoporosis by promoting osteogenesis and angiogenesis coupling
Journal: PeerJ | Authors: Junjie Jia | Species: mouse,rat | Application: WB,IF - CAV1 up-regulated by peste des petits ruminants virus nucleocapsid protein impairs type I IFN response by cholesterol synthesis.
Journal: Vet Microbiol | Authors: Bo Wen - Invasion of Mycoplasma bovis into bovine synovial cells utilizing the clathrin-dependent endocytosis pathway.
Journal: Vet Microbiol | Authors: Koji Nishi | Species: bovine | Application: WB,IF - Caveolin-1 modulates cisplatin sensitivity in oral squamous cell carcinoma through ferroptosis
Journal: Clin Transl Oncol | Authors: Weilin Zhang | Species: human | Application: IHC - CXCR4 promotes gefitinib resistance of Huh7 cells by activating the c-Met signaling pathway.
Journal: FEBS Open Bio | Authors: Dali Zhao | Species: human | Application: WB - Complement factor H drives idiopathic pulmonary fibrosis by autocrine C3 regulation, suppressing macrophage phagocytosis and enhancing fibrotic progression
Journal: Biochem Biophys Res Commun | Authors: Dan Ma | Species: human | Application: WB - The tyrosine phosphorylation of GRK2 is responsible for activated D2R-mediated insulin resistance
Journal: Biochem Biophys Res Commun | Authors: Zhenglin Gao | Species: mouse | Application: WB - Metformin alleviates high glucose-induced ER stress and inflammation by inhibiting the interaction between caveolin1 and AMPKα in rat astrocytes.
Journal: Biochem Biophys Res Commun | Authors: Gang Wang | Species: rat | Application: WB,IP - The tyrosine phosphorylation of GRK2 is responsible for activated D2R-mediated insulin resistance
Journal: Biochem Biophys Res Commun | Authors: Zhenglin Gao | Species: mouse | Application: WB - Postoperative Impairment of GluA2 Ttrafficking in CA3 Induces Memory Consolidation Deficits in Aged Mice by Disrupting SPW-R in CA1.
Journal: J Mol Neurosci | Authors: Zi-Qing Xu - Endothelial cell membrane cholesterol content regulates the contribution of TRPV4 channels in ACh-induced vasodilation in rat gracilis arteries.
Journal: Microcirculation | Authors: Emily E Morin | Species: rat | Application: WB - Up-regulation of caveolin 1 mediated by chitosan activates Wnt/ β-catenin pathway in chronic refractory wound diabetic rat model.
Journal: Bioengineered | Authors: Jie Gao | Species: rat | Application: IP - Effects of caffeic acid phenethyl ester use and inhibition of p42/44 MAP kinase signal pathway on caveolin 1 gene expression and antioxidant system in chronic renal failure model of rats.
Journal: Drug Chem Toxicol | Authors: Yilmaz Cigremis | Species: rat | Application: IHC - miR-203 inhibits tumor cell migration and invasion via caveolin-1 in pancreatic cancer cells.
Journal: Oncol Lett | Authors: Lifeng Miao | Species: human | Application: WB - Xinnaokang improves cecal microbiota and lipid metabolism to target atherosclerosis.
Journal: Lett Appl Microbiol | Authors: R Yang | Species: mouse | Application: WB - Prognostic and predictive values of SPP1, PAI and caveolin-1 in patients with oral squamous cell carcinoma.
Journal: Int J Clin Exp Pathol | Authors: Cong-Fa Huang | Species: human | Application: IHC - Syncytin-mediated open-ended membrane tubular connections facilitate the intercellular transfer of cargos including Cas9 protein
Journal: Elife | Authors: Congyan Zhang | Application: WB - Generation of alveolar organoids from human induced pluripotent stem cells using a stirred-tank bioreactor.
Journal: Front Bioeng Biotechnol | Authors: Bettina Budeus
Reviews
Write Your Own Review