ICOS Monoclonal antibody, PBS Only (Capture) 68836-1-PBS proteintech
$699.00
In stock
SKU
68836-1-PBS
| Catalog Number | 68836-1-PBS |
| Synonyms | AILIM, CD278, ICOS, inducible T cell co stimulator, Inducible T cell costimulator |
| Host | Mouse |
| Reactivity | Human |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Indirect ELISA, Cytometric bead array |
| Host / Isotype | Mouse / IgG1 |
| Tested Reactivity | Human |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag27722 Product name: Recombinant human ICOS protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-142 aa of BC028210 Sequence: MKSGLWYFFLFCLRIKVLTGEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLKFW Predict reactive species |
| Full Name | inducible T-cell co-stimulator |
| Calculated Molecular Weight | 199 aa, 23 kDa |
| GenBank Accession Number | BC028210 |
| Gene Symbol | ICOS |
| Gene ID (NCBI) | 29851 |
| Conjugate | Unconjugated |
| Purification Method | Protein G purification |
| UNIPROT ID | Q9Y6W8 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Clone Number | 2B1B6 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
