CDX2 Recombinant monoclonal antibody 82659-1-RR proteintech
$149.00
In stock
SKU
82659-1-RR
| Catalog Number | 82659-1-RR |
| Synonyms | Caudal type homeobox 2, Caudal type homeobox protein 2, Caudal-type homeobox protein 2, CDX 3, CDX-2 |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | Caco-2 cells, mouse colon tissue, COLO 320 cells |
| Tested Applications — Positive IHC detected in | rat colon tissue, human colon cancer tissue, human rectal cancer tissue, mouse colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | Caco-2 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:5000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:500-1:2000 |
| Positive WB detected in | Caco-2 cells, mouse colon tissue, COLO 320 cells |
| Positive IHC detected in | rat colon tissue, human colon cancer tissue, human rectal cancer tissue, mouse colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | Caco-2 cells |
| Western Blot (WB) | WB : 1:1000-1:5000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:500-1:2000 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag17310 Product name: Recombinant human CDX2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-180 aa of BC014461 Sequence: MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQSPGPSWPAAYGAPLREDWNGYAPGGAAAAANAVAHGLNGGSPAAAMGYSSPADYHPHHHPHHHPHHPAAAPSCASGLLQTLNPGPPGPAATAAAEQLSPGGQRRNLCEWMRKPAQQSLGSQ Predict reactive species |
| Full Name | caudal type homeobox 2 |
| Calculated Molecular Weight | 313 aa, 34 kDa |
| Observed Molecular Weight | 33-40 kDa |
| GenBank Accession Number | BC014461 |
| Gene Symbol | CDX2 |
| Gene ID (NCBI) | 1045 |
| RRID | AB_3086497 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q99626 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for CDX2 antibody 82659-1-RR | Download protocol |
| IHC protocol for CDX2 antibody 82659-1-RR | Download protocol |
| WB protocol for CDX2 antibody 82659-1-RR | Download protocol |
| human | IHC Exp Ther Med Appendiceal mucinous tumour resulting in autoamputation of the appendix: A case report and literature review. Authors - Chenao Wang View Article |
| rat,human | WB,IHC Chin Med Weiyan Tongluo Granules attenuate gastric intestinal metaplasia through PPARγ/NF-κB/CDX2 signaling pathway. Authors - Yimin Liang View Article |
| rat | IHC Transl Oncol L-theanine's therapeutic effects on colorectal cancer: Mechanistic insights from a 1,2-dimethylhydrazine-induced rat model. Authors - Jimusi View Article |
| mouse,human | WB Phytomedicine JianPi QingRe HuoXue Formula targets Cadherin-17 to induce apoptosis in chronic atrophic gastritis with intestinal metaplasia. Authors - Zihan Mai View Article |
| mouse | IHC Phytomedicine Huo Po Xia Ling decoction exerts preventive and improvement effects on gastric precancerous lesions by remodeling gut microbiota and associated metabolites. Authors - Yanru Song View Article |
| Citations | 6 |
| Dilutions | WB : 1:1000-1:5000 IHC : 1:500-1:2000 IF/ICC : 1:500-1:2000 |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 3J1 |
| Conjugation | Unconjugated |
CDX2, also named as Homeobox protein CDX-2, is a 313 amino acid protein, which contains one homeobox DNA-binding domain and belongs to the Caudal homeobox family. CDX2 localizes in the nucleus and is involved in the transcriptional regulation of multiple genes expression in the intestinal epithelium. The relative expression of CDX1 to CDX2 protein may be important in the anterior to posterior patterning of the intestinal epithelium and in defining patterns of proliferation and differentiation along the crypt-villus axis. Both Cdx1 and Cdx2 genes must be expressed to reduce tumorigenic potential, to increase sensitivity to apoptosis, and to reduce cell migration, suggesting that the two genes control the normal phenotype by independent pathways. Protocols Product Specific Protocols IF protocol for CDX2 antibody 82659-1-RR Download protocol IHC protocol for CDX2 antibody 82659-1-RR Download protocol WB protocol for CDX2 antibody 82659-1-RR Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- 3D bioprinting platform development for high-throughput cancer organoid models construction and drug evaluation
Journal: Biofabrication | Authors: Rui Dai | Species: human | Application: IF - Weiyan Tongluo Granules attenuate gastric intestinal metaplasia through PPARγ/NF-κB/CDX2 signaling pathway.
Journal: Chin Med | Authors: Yimin Liang | Species: rat,human | Application: WB,IHC - L-theanine's therapeutic effects on colorectal cancer: Mechanistic insights from a 1,2-dimethylhydrazine-induced rat model.
Journal: Transl Oncol | Authors: Jimusi | Species: rat | Application: IHC - JianPi QingRe HuoXue Formula targets Cadherin-17 to induce apoptosis in chronic atrophic gastritis with intestinal metaplasia.
Journal: Phytomedicine | Authors: Zihan Mai | Species: mouse,human | Application: WB - Appendiceal mucinous tumour resulting in autoamputation of the appendix: A case report and literature review.
Journal: Exp Ther Med | Authors: Chenao Wang | Species: human | Application: IHC - Huo Po Xia Ling decoction exerts preventive and improvement effects on gastric precancerous lesions by remodeling gut microbiota and associated metabolites.
Journal: Phytomedicine | Authors: Yanru Song | Species: mouse | Application: IHC
Reviews
Write Your Own Review