CoraLite® Plus 488 Anti-Mouse IFN-gamma Rabbit Recombinant Antibody CL488-98045 proteintech
$151.00
In stock
SKU
CL488-98045
| Catalog Number | CL488-98045 |
| Synonyms | IFN gamma, Ifng, 240262C9, Ifg, IFN g |
| Host | Rabbit |
| Reactivity | mouse |
| Form | Liquid |
| Formulation | PBS, Azide |
| Applications | FC (Intra) |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive FC (Intra) detected in | PMA, Ionomycin and Brefeldin A treated C57BL/6 Th1-polarized splenocytes |
| Recommended Dilutions — Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension |
| Positive FC (Intra) detected in | PMA, Ionomycin and Brefeldin A treated C57BL/6 Th1-polarized splenocytes |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension |
| Tested Reactivity | mouse |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Eg0334 Product name: Recombinant Mouse IFN-gamma/IFNG protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 23-155 aa of BC119063 Sequence: HGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC Predict reactive species |
| Full Name | interferon gamma |
| Calculated Molecular Weight | 17 kDa |
| GenBank Accession Number | BC119063 |
| Gene Symbol | IFN gamma |
| Gene ID (NCBI) | 15978 |
| RRID | AB_3673387 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Excitation Laser | Blue laser (488 nm) |
| Purification Method | Protein A purification |
| UNIPROT ID | P01580 |
| Storage Buffer | PBS with 0.09% sodium azide, pH 7.3. |
| Storage Conditions | Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment. |
| FC protocol for CL Plus 488 IFN-gamma antibody CL488-98045 | Download protocol |
| Citations | - |
| Dilutions | FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 240262C9 |
| Conjugation | CoraLite® Plus 488 |
Interferon gamma (IFN γ), is a type II interferon that provides immunity against bacterial, viral and protozoan infections. In its active form, IFN γ is a glycosylated, non-covalently linked homodimer of 29-32 kDa subunits. It is produced by a number of immune cell types including natural killer cells, natural killer T cells, and effector lymphocyte T cells following antigenic and inflammatory triggers. The IFN γ dimer binds to its cognate receptor which has two subunits: IFN-γR1 which is the ligand-binding chain (α chain) and IFN-γR2, the signal-transducing chain (β chain). Binding to the receptor activates the JAK/STAT pathway which in turn activates IFN γ responsive genes. While IFN γ can inhibit viral replication, it also works as an immune-modulator and immune-stimulator by increasing surface expression of class I MHC proteins. (PMID: 19268625; 10688427) Protocols Product Specific Protocols FC protocol for CL Plus 488 IFN-gamma antibody CL488-98045 Download protocol Standard Protocols Click here to view our Standard Protocols
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
