CoraLite®594 Anti-Rat IFN-gamma Rabbit Recombinant Antibody CL594-98001 proteintech
$158.00
In stock
SKU
CL594-98001
| Catalog Number | CL594-98001 |
| Synonyms | IFN Gamma, Ifng, interferon gamma, 6K20, IFN γ |
| Host | Rabbit |
| Reactivity | rat |
| Form | Liquid |
| Formulation | PBS, Azide |
| Applications | FC (Intra) |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive FC (Intra) detected in | ConA, PMA and ionomycin stimulated rat splenocytes |
| Recommended Dilutions — Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension |
| Positive FC (Intra) detected in | ConA, PMA and ionomycin stimulated rat splenocytes |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension |
| Tested Reactivity | rat |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Eg0400 Product name: Recombinant Rat IFN-gamma protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 23-156 aa of NM_138880 Sequence: QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC Predict reactive species |
| Full Name | interferon gamma |
| Calculated Molecular Weight | 18 kDa |
| GenBank Accession Number | NM_138880 |
| Gene Symbol | IFN-gamma |
| Gene ID (NCBI) | 25712 |
| RRID | AB_3748264 |
| Conjugate | CoraLite®594 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 588 nm / 604 nm |
| Excitation Laser | Yellow-Green Laser (561 nm) |
| Purification Method | Protein A purification |
| UNIPROT ID | P01581 |
| Storage Buffer | PBS with 0.09% sodium azide, pH 7.3. |
| Storage Conditions | Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment. |
| FC protocol for CL594 IFN-gamma antibody CL594-98001 | Download protocol |
| Citations | - |
| Dilutions | FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 6K20 |
| Conjugation | CoraLite®594 |
Interferon-gamma (IFN γ), is a type II interferon that provides immunity against bacterial, viral and protozoan infections. It is produced by a number of immune cell types including natural killer cells, natural killer T cells, and effector lymphocyte T cells following antigenic and inflammatory triggers. The IFN γ dimer binds to its cognate receptor which has two subunits: IFN-γR1 which is the ligand-binding chain (α chain) and IFN-γR2, the signal-transducing chain (β chain). Binding to the receptor activates the JAK/STAT pathway which in turn activates IFN γ responsive genes. While IFN γ can inhibit viral replication, it also works as an immune-modulator and immune-stimulator by increasing surface expression of class I MHC proteins (PMID: 19268625; 10688427) Protocols Product Specific Protocols FC protocol for CL594 IFN-gamma antibody CL594-98001 Download protocol Standard Protocols Click here to view our Standard Protocols
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
