Rat IGF1 Recombinant monoclonal antibody, PBS Only 84782-5-PBS proteintech
$699.00
In stock
SKU
84782-5-PBS
| Catalog Number | 84782-5-PBS |
| Synonyms | 241890G6, Igf-1, IGF-I, Insulin-like growth factor I, Somatomedin |
| Host | Rabbit |
| Reactivity | rat |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | WB, IHC, IF/ICC, FC (Intra), Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | rat |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Eg1976 Product name: Recombinant Rat IGF1 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 23-92 aa of AAA41386 Sequence: GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKSA Predict reactive species |
| Full Name | insulin-like growth factor 1 |
| Calculated Molecular Weight | 14kd |
| Observed Molecular Weight | 12 kDa |
| GenBank Accession Number | AAA41386 |
| Gene Symbol | Igf1 |
| Gene ID (NCBI) | 24482 |
| RRID | AB_3743730 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P08025 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 241890G6 |
| Conjugation | Unconjugated |
IGF1, also named as IBP1, MGF, IGF-IA, and Somatomedin-C, belongs to the INS family. IGF1 is structurally and functionally related to INS but has a much higher growth-promoting activity. Altered expression or mutation of IGF-1 is associated with several human disorders, including type I diabetes and various forms of cancer. Defects in IGF1 are the cause of INS-like growth factor I deficiency (IGF1 deficiency) which is an autosomal recessive disorder characterized by growth retardation, sensorineural deafness, and mental retardation.
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
