IGFL4 Polyclonal antibody 33339-1-AP proteintech
$149.00
In stock
SKU
33339-1-AP
| Catalog Number | 33339-1-AP |
| Synonyms | Insulin growth factor-like family member 4 |
| Host | Rabbit |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive IHC detected in | mouse cerebellum tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Positive IHC detected in | mouse cerebellum tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Tested Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag37543 Product name: Recombinant human IGFL4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 20-124 aa of NM_001002923 Sequence: EGVTDLRLWLCQPAPRCGEWTYNPLEQCCDDGVILDLNQTRLCGSSCTFWPCFQHCCLESLGSQNQTVVRFKVPGMKPDCKSSPITRICAQEYHPKSPVSRSDLI Predict reactive species |
| Full Name | IGF-like family member 4 |
| Calculated Molecular Weight | 14 kDa |
| GenBank Accession Number | NM_001002923 |
| Gene Symbol | IGFL4 |
| Gene ID (NCBI) | 444882 |
| RRID | AB_3742946 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q6B9Z1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for IGFL4 antibody 33339-1-AP | Download protocol |
| Citations | - |
| Dilutions | IHC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
IGFL (Insulin-like growth factor like family) encode a family of small secreted proteins in Homo sapiens and Mus musculus. This family consists of four genes and two pseudogenes (IGFL1-4 and IGFL1P1-2). IGFL1 is expressed in the ovary and spinal cord. IGFL2 is expressed in the cerebellum, heart, placenta, spleen, stomach, testis and thymus. IGFL3 and IGFL4 are expressed in the cerebellum. The IGFL4 protein binds to the insulin-like growth factor receptor (IGF-1R) and the insulin receptor (IR), thereby activating downstream signaling pathways such as the PI3K/AKT and MAPK pathway.(PMID: 16890402). Protocols Product Specific Protocols IHC protocol for IGFL4 antibody 33339-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
