CD53 Recombinant monoclonal antibody 85838-3-RR proteintech
$149.00
In stock
SKU
85838-3-RR
| Catalog Number | 85838-3-RR |
| Synonyms | Cell surface glycoprotein CD53, Leukocyte surface antigen CD53 |
| Host | Rabbit |
| Reactivity | mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | RAW 264.7 cells |
| Tested Applications — Positive IHC detected in | mouse spleen tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | A20 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:2000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:250-1:1000 |
| Positive WB detected in | RAW 264.7 cells |
| Positive IHC detected in | mouse spleen tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A20 cells |
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:250-1:1000 |
| Tested Reactivity | mouse |
| Cited Reactivity | mouse |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Eg2684 Product name: Recombinant Mouse CD53 protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 107-181 aa of NM_007651.3 Sequence: EQKLNTLVAEGLNDSIQHYHSDNSTMKAWDFIQTQLQCCGVNGSSDWTSGPPSSCPSGADVQGCYNKAKSWFHSN Predict reactive species |
| Full Name | CD53 antigen |
| Calculated Molecular Weight | 24 kDa |
| Observed Molecular Weight | 35-40 kDa |
| GenBank Accession Number | NM_007651.3 |
| Gene Symbol | Cd53 |
| Gene ID (NCBI) | 12508 |
| RRID | AB_3744413 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q61451 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for CD53 antibody 85838-3-RR | Download protocol |
| IHC protocol for CD53 antibody 85838-3-RR | Download protocol |
| WB protocol for CD53 antibody 85838-3-RR | Download protocol |
| mouse | WB Front Cell Dev Biol Integrated bioinformatics and machine learning to explore the common mechanisms and potential biomarkers between periodontitis and preterm birth. Authors - Feng Mei View Article |
| Citations | 1 |
| Dilutions | WB : 1:500-1:2000 IHC : 1:1000-1:4000 IF/ICC : 1:250-1:1000 |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 250105D10 |
| Conjugation | Unconjugated |
CD53 is also named as MOX44 and Tetraspanin-25 (Tspan-25). Tetraspanin CD53 is a member of the tetraspanin superfamily expressed exclusively within the immune compartment (PMID: 32440787). T cells depend on the phosphatase CD45 to initiate T cell receptor signaling. CD53 is shown to stabilize CD45 on the membrane and is required for optimal phosphatase activity and subsequent Lck activation. Together, CD53 as a regulator of CD45 activity required for T cell immunity (PMID: 35767951). CD53 is a marker for positively selected CD4+ CD8+ thymocytes (PMID: 11867561). Protocols Product Specific Protocols IF protocol for CD53 antibody 85838-3-RR Download protocol IHC protocol for CD53 antibody 85838-3-RR Download protocol WB protocol for CD53 antibody 85838-3-RR Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Integrated bioinformatics and machine learning to explore the common mechanisms and potential biomarkers between periodontitis and preterm birth.
Journal: Front Cell Dev Biol | Authors: Feng Mei | Species: mouse | Application: WB
Reviews
Write Your Own Review