IL-10 Recombinant monoclonal antibody, PBS Only (Detector) 86547-1-PBS proteintech
$699.00
In stock
SKU
86547-1-PBS
| Catalog Number | 86547-1-PBS |
| Synonyms | IL-10,IL10, CSIF, IL 10, IL10, IL10A |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Sandwich ELISA, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Eg3296 Product name: Recombinant Human IL-10 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 19-178 aa of NM_000572.3 Sequence: SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN Predict reactive species |
| Full Name | interleukin 10 |
| Calculated Molecular Weight | 21 kDa |
| GenBank Accession Number | NM_000572.3 |
| Gene Symbol | IL-10 |
| Gene ID (NCBI) | 3586 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P22301 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 250059C12 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
