Anti-Rat IL-17A Rabbit Recombinant Antibody, PBS Only 98564-1-PBS proteintech
$976.00
In stock
SKU
98564-1-PBS
| Catalog Number | 98564-1-PBS |
| Synonyms | Il17a, Interleukin 17A |
| Host | Rabbit |
| Reactivity | rat |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | FC (Intra) |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | rat |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Eg3339 Product name: Recombinant Rat IL-17A protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 18-150 aa of Sequence: AVLIPQSSVCPNAEANNFLQNVKVNLKVINSLSSKASSRRPSDYLNRSTSPWTLSRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPEKCPFTFRVEKMLVGVGCTCVSSIVRHAS Predict reactive species |
| Full Name | similar to Interleukin-17 precursor (IL-17) (Cytotoxic T lymphocyte-associated antigen 8) (CTLA-8) |
| Calculated Molecular Weight | 17kDa |
| Gene Symbol | LOC301289 |
| Gene ID (NCBI) | 301289 |
| RRID | AB_3746182 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q61453 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 250413G7 |
| Conjugation | Unconjugated |
IL-17A, also named as IL-17, is a proinflammatory cytokine. IL-17, synthesized only by memory T cells and natural killer cells, has pleiotropic effects, mainly in the recruitment and activation of neutrophils. This cytokine regulates the activities of NF-kappaB and mitogen-activated protein kinases. This cytokine can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO). High levels of this cytokine are associated with several chronic inflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis. The IL-17 receptor is a type I transmembrane protein, that is widely expressed on epithelial cells, fibroblasts, B and T cells, and monocytic cells. In psoriatic skin lesions, both Th17 cells and their downstream effector molecules, e.g. IL-17 and IL-22, are highly increased.
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
