DENND6A Recombinant monoclonal antibody 83473-3-RR proteintech
$149.00
In stock
SKU
83473-3-RR
| Catalog Number | 83473-3-RR |
| Synonyms | FAM116A, 240486B9, DENN domain-containing protein 6A, Protein DENND6A, Protein FAM116A |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, FC (Intra), ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | PC-3 cells, HEK-293 cells |
| Tested Applications — Positive FC (Intra) detected in | HepG2 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:2000-1:10000 |
| Recommended Dilutions — Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| Positive WB detected in | PC-3 cells, HEK-293 cells |
| Positive FC (Intra) detected in | HepG2 cells |
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag22052 Product name: Recombinant human FAM116A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-60 aa of BC040291 Sequence: MALRGPAGLGPGSRRPLDEAVAGAEGREAPALVAAGGAPEDDEEDDGRGRGLLRWDSFSA Predict reactive species |
| Full Name | family with sequence similarity 116, member A |
| Calculated Molecular Weight | 608 aa, 70 kDa |
| Observed Molecular Weight | 61 kDa |
| GenBank Accession Number | BC040291 |
| Gene Symbol | FAM116A |
| Gene ID (NCBI) | 201627 |
| RRID | AB_3671102 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q8IWF6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| FC protocol for DENND6A antibody 83473-3-RR | Download protocol |
| WB protocol for DENND6A antibody 83473-3-RR | Download protocol |
| Citations | - |
| Dilutions | WB : 1:2000-1:10000 FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 240486B9 |
| Conjugation | Unconjugated |
FAM116A has DENN-related domains, which are required for cell migration. Protocols Product Specific Protocols FC protocol for DENND6A antibody 83473-3-RR Download protocol WB protocol for DENND6A antibody 83473-3-RR Download protocol Standard Protocols Click here to view our Standard Protocols
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
