IL-22 Recombinant monoclonal antibody, PBS Only (Detector) 82766-11-PBS proteintech
$699.00
In stock
SKU
82766-11-PBS
| Catalog Number | 82766-11-PBS |
| Synonyms | PBS Only |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Applications | Cytometric bead array, Sandwich ELISA, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Eg0228 Product name: Recombinant Human IL-22 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: N-6*HIS Domain: 34-179 aa of BC070261 Sequence: MAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI Predict reactive species |
| Full Name | interleukin 22 |
| Calculated Molecular Weight | 179 aa, 20 kDa |
| GenBank Accession Number | BC070261 |
| Gene Symbol | IL-22 |
| Gene ID (NCBI) | 50616 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9GZX6 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 240699A4 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
