IMUP Recombinant monoclonal antibody 84148-7-RR proteintech
$149.00
In stock
SKU
84148-7-RR
| Catalog Number | 84148-7-RR |
| Synonyms | 241220A4, C19orf33, H2RSP, HAI-2-related small protein, Hepatocyte growth factor activator inhibitor type 2-related small protein |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, FC (Intra), ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HeLa cells, L02 cells, A549 cells, EC109 cells |
| Tested Applications — Positive FC (Intra) detected in | A431 cells, PC-3 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:6000 |
| Recommended Dilutions — Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| Positive WB detected in | HeLa cells, L02 cells, A549 cells, EC109 cells |
| Positive FC (Intra) detected in | A431 cells, PC-3 cells |
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| Tested Reactivity | human |
| Cited Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag22218 Product name: Recombinant human C19orf33 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-85 aa of BC060319 Sequence: MEFDLGAALEPTSQKPGVGAGHGGDPKLSPHKVQGRSEAGAGPGPKASNFRGLGKGRRLTAAPPSSKDTTALPTPAAAPAIRTRM Predict reactive species |
| Full Name | chromosome 19 open reading frame 33 |
| Calculated Molecular Weight | 106 aa, 11 kDa |
| Observed Molecular Weight | 20-22 kDa |
| GenBank Accession Number | BC060319 |
| Gene Symbol | IMUP |
| Gene ID (NCBI) | 64073 |
| RRID | AB_3671712 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purfication |
| UNIPROT ID | Q9GZP8 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| WB protocol for IMUP antibody 84148-7-RR | Download protocol |
| human | Tissue Cell IMUP promotes fatty acid metabolism and lung cancer progression by regulating TGF-β/SMAD3 signaling pathway Authors - Shuang Wu View Article |
| Citations | 1 |
| Dilutions | WB : 1:1000-1:6000 FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 241220A4 |
| Conjugation | Unconjugated |
Immortalization up-regulated protein (IMUP), also known as C19orf33 or H2RSP, was first identified in SV40-immortalized fibroblasts and includes two isoforms, IMUP-1 and IMUP-2 (PMID: 14981917; 35142956). It is found primarily in the nucleus (PMID: 11606055). IMUP is reportedly upregulated in many cancer cells and tissues and its overexpression is associated with tumorigenicity and cell-cycle acceleration (PMID: 16962562; 35142956; 22886722). The apparent molecular determined by SDS-PAGE might be due to post-translational modifications or anomalous migration behavior (PMID: 11080599). Protocols Product Specific Protocols WB protocol for IMUP antibody 84148-7-RR Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- IMUP promotes fatty acid metabolism and lung cancer progression by regulating TGF-β/SMAD3 signaling pathway
Journal: Tissue Cell | Authors: Shuang Wu | Species: human
Product Documents
Reviews
Write Your Own Review