Ins1 Recombinant monoclonal antibody 83867-1-RR proteintech
$149.00
In stock
SKU
83867-1-RR
| Catalog Number | 83867-1-RR |
| Synonyms | Insulin, insulin1, insulin I, Ins2 rs1, Ins-1 |
| Host | Rabbit |
| Reactivity | mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF-P, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | rat pancreas tissue |
| Tested Applications — Positive IHC detected in | mouse pancreas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF-P detected in | mouse pancreas tissue |
| Recommended Dilutions — Western Blot (WB) | WB : 1:2000-1:10000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:5000-1:20000 |
| Recommended Dilutions — Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Positive WB detected in | rat pancreas tissue |
| Positive IHC detected in | mouse pancreas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse pancreas tissue |
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:5000-1:20000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Tested Reactivity | mouse, rat |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag29988 Product name: Recombinant mouse insulin1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-87 aa of NM_008386 Sequence: FVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVEDPQVEQLELGGSPGDLQTLALEVARQKR Predict reactive species |
| Full Name | insulin I |
| Calculated Molecular Weight | 12 kDa |
| Observed Molecular Weight | 12 kDa |
| GenBank Accession Number | NM_008386 |
| Gene Symbol | Ins1 |
| Gene ID (NCBI) | 16333 |
| RRID | AB_3671453 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purfication |
| UNIPROT ID | P01325 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for Ins1 antibody 83867-1-RR | Download protocol |
| IHC protocol for Ins1 antibody 83867-1-RR | Download protocol |
| WB protocol for Ins1 antibody 83867-1-RR | Download protocol |
| Citations | - |
| Dilutions | WB : 1:2000-1:10000 IHC : 1:5000-1:20000 IF-P : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 240798G4 |
| Conjugation | Unconjugated |
Insulin 1 is a peptide hormone that plays a vital role in the regulation of carbohydrate and lipid metabolism. The encoded precursor protein undergoes proteolytic cleavage to produce a disulfide-linked heterodimeric functional protein that is stored in secretory granules. An increase in blood glucose levels, among others, induces the release of insulin from the secretory granules. Mice deficient in the functional hormone encoded by this gene develop diabetes mellitus. Protocols Product Specific Protocols IF protocol for Ins1 antibody 83867-1-RR Download protocol IHC protocol for Ins1 antibody 83867-1-RR Download protocol WB protocol for Ins1 antibody 83867-1-RR Download protocol Standard Protocols Click here to view our Standard Protocols
Reviews
Write Your Own Review