INPP4B Polyclonal antibody 15890-1-AP proteintech
$149.00
In stock
SKU
15890-1-AP
| Catalog Number | 15890-1-AP |
| Synonyms | INPP4B |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | MCF-7 cells |
| Tested Applications — Positive IHC detected in | human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:4000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Positive WB detected in | MCF-7 cells |
| Positive IHC detected in | human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Tested Reactivity | human |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag8676 Product name: Recombinant human INPP4B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-53 aa of BC005273 Sequence: MEIKEEGASEEGQHFLPTAQANDPGDCQFTSIQKTPNEPQLEFILDLNQELRD Predict reactive species |
| Full Name | inositol polyphosphate-4-phosphatase, type II, 105kDa |
| Calculated Molecular Weight | 53 aa, 6 kDa |
| Observed Molecular Weight | 100-110 kDa |
| GenBank Accession Number | BC005273 |
| Gene Symbol | INPP4B |
| Gene ID (NCBI) | 8821 |
| RRID | AB_3669224 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O15327 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for INPP4B antibody 15890-1-AP | Download protocol |
| WB protocol for INPP4B antibody 15890-1-AP | Download protocol |
| Citations | - |
| Dilutions | WB : 1:1000-1:4000 IHC : 1:200-1:800 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
INPP4B (Inositol polyphosphate 4-phosphatase type II) can catalyze the hydrolysis of the 4-position phosphate of phosphatidylinositol 3,4-bisphosphate, inositol 1,3,4-trisphosphate and inositol 3,4-trisphosphate (PMID: 24070612; 24591580). It also Plays a role in the late stages of macropinocytosis by dephosphorylating phosphatidylinositol 3,4-bisphosphate in membrane ruffles (PMID: 24591580). Protocols Product Specific Protocols IHC protocol for INPP4B antibody 15890-1-AP Download protocol WB protocol for INPP4B antibody 15890-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols