INTS1 Recombinant monoclonal antibody, PBS Only 84339-5-PBS proteintech
$699.00
In stock
SKU
84339-5-PBS
| Catalog Number | 84339-5-PBS |
| Synonyms | KIAA1440, integrator complex subunit 1, INT1, 241627B1 |
| Host | Rabbit |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | WB, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human, mouse |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag35428 Product name: Recombinant human INTS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 280-400 aa of BC069262 Sequence: GAGSSPHPSLTEEEDSQTELLIAEEKLSPEQEGQLMPRYEELAESVEEYVLDMLRDQLNRRQPIDNVSRNLLRLLTSTCGYKEVRLLAVQKLEMWLQNPKLTRPAQDLLMSVCMNCNTHGS Predict reactive species |
| Full Name | integrator complex subunit 1 |
| Observed Molecular Weight | 245 kDa |
| GenBank Accession Number | BC069262 |
| Gene Symbol | INTS1 |
| Gene ID (NCBI) | 26173 |
| RRID | AB_3671880 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purfication |
| UNIPROT ID | Q8N201 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 241627B1 |
| Conjugation | Unconjugated |
INTS1 is a component of the Integrator (INT) complex, a complex involved in the small nuclear RNAs (snRNA) U1 and U2 transcription and in their 3'-box-dependent processing.
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
