Leptin Recombinant monoclonal antibody 83655-3-RR proteintech
$149.00
In stock
SKU
83655-3-RR
| Catalog Number | 83655-3-RR |
| Synonyms | Lep, 240368E6, OB |
| Host | Rabbit |
| Reactivity | rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | rat adipose tissue, human adipose tissue |
| Tested Applications — Positive IHC detected in | human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:2000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Positive WB detected in | rat adipose tissue, human adipose tissue |
| Positive IHC detected in | human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Tested Reactivity | rat |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Eg0892 Product name: Recombinant Rat Leptin protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: N-6*His Domain: 22-167 aa of NM_013076.3 Sequence: VPIHKVQDDTKTLIKTIVTRINDISHTQSVSARQRVTGLDFIPGLHPILSLSKMDQTLAVYQQILTSLPSQNVLQIAHDLENLRDLLHLLAFSKSCSLPQTRGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDLSPEC Predict reactive species |
| Full Name | leptin |
| Calculated Molecular Weight | 19 kDa |
| Observed Molecular Weight | 15-16 kDa |
| GenBank Accession Number | NM_013076.3 |
| Gene Symbol | Leptin |
| Gene ID (NCBI) | 25608 |
| RRID | AB_3671263 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purfication |
| UNIPROT ID | P50596 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for Leptin antibody 83655-3-RR | Download protocol |
| WB protocol for Leptin antibody 83655-3-RR | Download protocol |
| Citations | 1 |
| Dilutions | WB : 1:500-1:2000 IHC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 240368E6 |
| Conjugation | Unconjugated |
Leptin is a protein that is secreted by white adipocytes, and which plays a major role in the regulation of body weight. Leptin is the most critical hormone in the homeostatic regulation of energy balance among those so far discovered. Leptin primarily acts on the neurons of the mediobasal part of hypothalamus to regulate food intake, thermogenesis, and the blood glucose level. Leptin also has several endocrine functions, and is involved in the regulation of immune and inflammatory responses, hematopoiesis, angiogenesis and wound healing. Mutations in this gene and/or its regulatory regions cause severe obesity, and morbid obesity with hypogonadism. Leptin has also been linked to type 2 diabetes mellitus development. Protocols Product Specific Protocols IHC protocol for Leptin antibody 83655-3-RR Download protocol WB protocol for Leptin antibody 83655-3-RR Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- A novel NAMPT activator ameliorates obesity by repressing ACSL1-dependent lipid synthesis.
Journal: Acta Pharm Sin B | Authors: Zhi Jiang
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
