Lipocalin-2/NGAL Recombinant monoclonal antibody 83853-2-RR proteintech
$149.00
In stock
SKU
83853-2-RR
| Catalog Number | 83853-2-RR |
| Synonyms | Lcn2, Lipocalin2/NGAL, 240792C12, Alpha-2-microglobulin-related protein, Alpha-2U globulin-related protein |
| Host | Rabbit |
| Reactivity | mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | 3T3-L1 cells, mouse testis tissue, rat lung tissue |
| Tested Applications — Positive IHC detected in | mouse spleen tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:5000-1:50000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Positive WB detected in | 3T3-L1 cells, mouse testis tissue, rat lung tissue |
| Positive IHC detected in | mouse spleen tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Tested Reactivity | mouse, rat |
| Cited Reactivity | mouse, rat |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Eg1022 Product name: Recombinant Rat Lipocalin-2/NGAL protein (His Tag) (HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 21-198 aa of Sequence: QDSTQNLIPAPPLISVPLQPGFWTERFQGRWFVVGLAGNAVQKERQSRFTMYSTIYELQEDNSYNVTSILVRGQGCRYWIRTFVPSSRPGQFTLGNIHSYPQIQSYDVQVADTDYDQFAMVFFQKTSENKQYFKVTLYGRTKGLSDELKERFVSFAKSLGLKDNNIVFSVPTDQCIDN Predict reactive species |
| Full Name | lipocalin 2 |
| Calculated Molecular Weight | 22kDa |
| Observed Molecular Weight | 22-25 kDa |
| Gene Symbol | Lipocalin-2/NGAL |
| Gene ID (NCBI) | 170496 |
| RRID | AB_3671438 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P30152 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for Lipocalin-2/NGAL antibody 83853-2-RR | Download protocol |
| WB protocol for Lipocalin-2/NGAL antibody 83853-2-RR | Download protocol |
| mouse | IHC Clin Chim Acta Multi-omics identification of aging-related diagnostic genes and therapeutic targets in renal fibrosis. Authors - Supei Yin View Article |
| rat | WB Neuromolecular Med Exploring Core Genes Involved in Ischemic Stroke and the Therapeutic Potential of Hyperbaric Oxygen: Insights from Transcriptomic Analysis Authors - Yingcun Bao View Article |
| Benedicte (Verified Customer) (06-04-2026) | IHC staining of mouse colitic colon using 83853-2-RR. Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 83853-2-RR (Lipocalin-2/NGAL Rabbit RecAb ) at dilution of 1:200 (40x on NDPview). Heat mediated antigen retrieval with EDTA 1mM (pH 8.5). Applications: Immunohistochemistry Primary Antibody Dilution: 1:200 Cell Tissue Type: colitic mouse colon Lipocalin-2/NGAL Antibody Immunohistochemistry validation (1:200 dilution) in colitic mouse colon (Cat no:83853-2-RR) |
| Citations | 8 |
| Dilutions | WB : 1:5000-1:50000 IHC : 1:200-1:800 |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 240792C12 |
| Conjugation | Unconjugated |
Neutrophil gelatinase-associated lipocalin (NGAL, also known as lipocalin-2, siderocalin, or LCN2) is a small molecule of almost 25 kDa that belongs to the well-defined superfamily of proteins called lipocalins. NGAL was initially found in activated neutrophils, under its role as an innate antibacterial factor. However, it was subsequently shown that many other types of cells, including those in the kidney tubule, may produce NGAL in response to various injuries. NGAL may become one of the most promising next-generation biomarkers in clinical nephrology and beyond. This antibody recognizes rat Lipocalin-2/Ngal. Protocols Product Specific Protocols IHC protocol for Lipocalin-2/NGAL antibody 83853-2-RR Download protocol WB protocol for Lipocalin-2/NGAL antibody 83853-2-RR Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Enhancing the efficacy of ulcerative colitis treatment by inhibiting LCN2-mediated pyroptosis through traditional processing techniques: With the rhizome of Atractylodes macrocephala Koidz. as an example.
Journal: J Ethnopharmacol | Authors: Anran Zhang - Methionine restriction attenuates renal injury by suppressing macrophage polarization via IRF1 downregulation.
Journal: Food Funct | Authors: Wang Yi - Refined Jianpi Huayu Jiedu Decoction Attenuates TAM-Induced Spasmolytic Polypeptide-Expressing Metaplasia (SPEM) by Modulating LCN2-Associated Mitochondrial Dysfunction.
Journal: Pharmaceuticals (Basel) | Authors: Chongkai Fang KD Validated | Application: WB - Multi-omics identification of aging-related diagnostic genes and therapeutic targets in renal fibrosis.
Journal: Clin Chim Acta | Authors: Supei Yin | Species: mouse | Application: IHC - Exploring Core Genes Involved in Ischemic Stroke and the Therapeutic Potential of Hyperbaric Oxygen: Insights from Transcriptomic Analysis
Journal: Neuromolecular Med | Authors: Yingcun Bao | Species: rat | Application: WB - Nuclear protein 1 defends against acute pancreatitis by mitigating pancreatic acinar cell ferroptosis through the maintenance of cellular iron homeostasis.
Journal: Toxicol Appl Pharmacol | Authors: Xiangtian Zeng - Bioinformatic validation of LCN2 as a common hub gene for ferroptosis, pyroptosis and necroptosis in ulcerative colitis.
Journal: BMC Gastroenterol | Authors: Nannan Zhu | Species: mouse | Application: IHC - Rhein alleviates lethal renal ischemia-reperfusion injury via inhibition of NLRP3 inflammasomes by targeting PPARγ.
Journal: Biochem Pharmacol | Authors: Cheng Fu
Reviews
Write Your Own Review