Integrin alpha-5/CD49e Polyclonal antibody 27224-1-AP proteintech
$149.00
In stock
SKU
27224-1-AP
| Catalog Number | 27224-1-AP |
| Synonyms | Integrin Alpha-5, ITGA5, CD49 antigen-like family member E, CD49e, FNRA |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | A549 cells, HAP1 cells, HeLa cells, human placenta tissue, U2OS cells |
| Tested Applications — Positive IP detected in | human placenta tissue |
| Tested Applications — Positive IHC detected in | human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:8000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Positive WB detected in | A549 cells, HAP1 cells, HeLa cells, human placenta tissue, U2OS cells |
| Positive IP detected in | human placenta tissue |
| Positive IHC detected in | human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Tested Reactivity | human |
| Cited Reactivity | human |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag26098 Product name: Recombinant human ITGA5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 874-995 aa of NM_002205 Sequence: PINPKGLELDPEGSLHHQQKREAPSRSSASSGPQILKCPEAECFRLRCELGPLHQQESQSLQLHFRVWAKTFLQREHQPFSLQCEAVYKALKMPYRILPRQLPQKERQVATAVQWTKAEGSY Predict reactive species |
| Full Name | integrin, alpha 5 (fibronectin receptor, alpha polypeptide) |
| Calculated Molecular Weight | 115 kDa |
| Observed Molecular Weight | 135-150 kDa |
| GenBank Accession Number | NM_002205 |
| Gene Symbol | Integrin alpha 5 |
| Gene ID (NCBI) | 3678 |
| RRID | AB_2880807 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P08648 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for Integrin alpha-5/CD49e antibody 27224-1-AP | Download protocol |
| IP protocol for Integrin alpha-5/CD49e antibody 27224-1-AP | Download protocol |
| WB protocol for Integrin alpha-5/CD49e antibody 27224-1-AP | Download protocol |
| human | WB,IHC Sci Rep ITGA5 induces mesenchymal transformation to promote gliomas progression via PI3K/AKT/mTORC1 signaling pathway Authors - Moxuan Zhang View Article |
| Boyan (Verified Customer) (01-25-2019) | By WB, it labels a band at the expected molecular weight, but this band is very likely not the real protein, because it is increased during adipocyte differentiation, which should be decreased during the process according to literature.By IF, PFA fixation, it labels the protein in the nucleus. But according to literature, it is localised in the cell surface and the Gogli. Applications: Western Blot, Immunofluorescence, |
| Citations | 5 |
| Dilutions | WB : 1:1000-1:8000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Publications
- A Prognostic Nomogram for Hepatocellular Carcinoma Based on Wound Healing and Immune Checkpoint Genes
Journal: J Clin Transl Hepatol | Authors: Beiyuan Hu | Species: human | Application: IHC - Pan-cancer analysis of integrin alpha family and prognosis validation in head and neck squamous cell carcinoma.
Journal: Front Oncol | Authors: Shaojie Ji | Species: human | Application: IHC - ZNF460-mediated circRPPH1 promotes TNBC progression through ITGA5-induced FAK/PI3K/AKT activation in a ceRNA manner
Journal: Mol Cancer | Authors: Chuanpeng Zhang | Species: human | Application: WB - Targeting Reprogrammed Cancer-Associated Fibroblasts with Engineered Mesenchymal Stem Cell Extracellular Vesicles for Pancreatic Cancer Treatment
Journal: Biomater Res | Authors: Pengcheng Zhou KD Validated | Species: human | Application: WB - ITGA5 induces mesenchymal transformation to promote gliomas progression via PI3K/AKT/mTORC1 signaling pathway
Journal: Sci Rep | Authors: Moxuan Zhang | Species: human | Application: WB,IHC
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
