MFN2 Recombinant monoclonal antibody 82673-2-RR proteintech
$149.00
In stock
SKU
82673-2-RR
| Catalog Number | 82673-2-RR |
| Synonyms | CPRP1, EC:3.6.5.-, HSG, KIAA0214, MARF |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IHC-Autostainer, IF/ICC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HepG2 cells, K-562 cells, NIH/3T3 cells, HSC-T6 cells |
| Tested Applications — Positive IHC-Autostainer detected in | Human Small Bowel Tissue |
| Tested Applications — Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HepG2 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:5000-1:50000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Positive WB detected in | HepG2 cells, K-562 cells, NIH/3T3 cells, HSC-T6 cells |
| Positive IHC-Autostainer detected in | Human Small Bowel Tissue |
| Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC)-AUTOSTAINER | IHC-AUTOSTAINER : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag2845 Product name: Recombinant human MFN2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2-353 aa of BC017061 Sequence: SLLFSRCNSIVTVKKNKRHMAEVNASPLKHFVTAKKKINGIFEQLGAYIQESATFLEDTYRNAELDPVTTEEQVLDVKGYLSKVRGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVEGTDGHEAFLLTEGSEEKRSAKTVNQLAHALHQDKQLHAGSLVSVMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKHFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHMERCTSFLVDELGVVDRSQAGDRIFFVSAKEVLNARIQKAQGMPEGGGALAEGFQVRMFEFQNFERRFEECISQSA Predict reactive species |
| Full Name | mitofusin 2 |
| Calculated Molecular Weight | 757 aa, 86 kDa |
| Observed Molecular Weight | 86 kDa |
| GenBank Accession Number | BC017061 |
| Gene Symbol | MFN2 |
| Gene ID (NCBI) | 9927 |
| ENSEMBL Gene ID | ENSG00000116688 |
| RRID | AB_3086501 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | O95140 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for MFN2 antibody 82673-2-RR | Download protocol |
| IHC protocol for MFN2 antibody 82673-2-RR | Download protocol |
| WB protocol for MFN2 antibody 82673-2-RR | Download protocol |
| human | IF Cancer Lett MFN2-CD36 interaction regulates mitochondrial lipid digestion in cancer-associated fibroblasts and promotes esophageal squamous cell carcinoma progression. Authors - Xiao Shi View Article |
| mouse | WB J Ethnopharmacol Senkyunolide a from danggui buxue decoction protects podocytes against diabetic nephropathy via the mir-223-3p/nlrp3 inflammasome axis. Authors - Zhe Lv View Article |
| Citations | 3 |
| Dilutions | WB : 1:5000-1:50000 IHC-AUTOSTAINER : 1:500-1:2000 IHC : 1:1000-1:4000 IF/ICC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 2A5 |
| Conjugation | Unconjugated |
Mitofusin-2 (MFN2), a mitochondrial membrane protein, is a dynamin-like GTPase embedded in the outer mitochondrial membrane (OMM) which plays a central role in regulating mitochondrial fusion and cell metabolism (PMID: 35399520; 34026850). There are two human mitofusin isoforms MFN1 and MFN2, MFN1 and MFN2 mediate outer membrane fusion, OPA1 is involved in inner membrane fusion, and DRP1 is responsible for mitochondrial fission (PMID: 17084350; 35399520). It has been shown that MFN2 participates in multiple cellular biological processes under physical and pathological conditions. Apart from mitochondria fusion, MFN2 is also involved in mitochondrial-ER contacts (MERCs), mitophagy, cellular apoptosis, and proliferation (PMID: 34026850). Protocols Product Specific Protocols IF protocol for MFN2 antibody 82673-2-RR Download protocol IHC protocol for MFN2 antibody 82673-2-RR Download protocol WB protocol for MFN2 antibody 82673-2-RR Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- MFN2-CD36 interaction regulates mitochondrial lipid digestion in cancer-associated fibroblasts and promotes esophageal squamous cell carcinoma progression.
Journal: Cancer Lett | Authors: Xiao Shi | Species: human | Application: IF - Alleviation of metabolic dysfunction-associated steatotic liver disease by silymarin is associated with maintaining mitochondrial homeostasis via regulation of optic atrophy 1.
Journal: J Pharmacol Exp Ther | Authors: Ming-Qiang Liu | Species: mouse | Application: WB - Senkyunolide a from danggui buxue decoction protects podocytes against diabetic nephropathy via the mir-223-3p/nlrp3 inflammasome axis.
Journal: J Ethnopharmacol | Authors: Zhe Lv | Species: mouse | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
