Mouse IFN-gamma Recombinant monoclonal antibody, PBS Only (Detector) 82768-4-PBS proteintech
$699.00
In stock
SKU
82768-4-PBS
| Catalog Number | 82768-4-PBS |
| Synonyms | IFN gamma, Ifng, Ifg, IFN g, IFN γ |
| Host | Rabbit |
| Reactivity | mouse |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Cytometric bead array, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | mouse |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Eg0334 Product name: Recombinant Mouse IFN-gamma/IFNG protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 23-155 aa of BC119063 Sequence: HGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC Predict reactive species |
| Full Name | interferon gamma |
| Calculated Molecular Weight | 17 kDa |
| GenBank Accession Number | BC119063 |
| Gene Symbol | IFN gamma |
| Gene ID (NCBI) | 15978 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P01580 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 240262B6 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
