CoraLite® Plus 488-conjugated Integrin Alpha V Polyclonal antibody CL488-27096 proteintech
$479.00
In stock
SKU
CL488-27096
| Catalog Number | CL488-27096 |
| Synonyms | ITGAV, CD51, Integrin alpha-V, Integrin alpha-V heavy chain, Integrin alpha-V light chain |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Proclin300, BSA, Glycerol |
| Applications | IF/ICC |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive IF/ICC detected in | A549 cells |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Positive IF/ICC detected in | A549 cells |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Tested Reactivity | human |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag25825 Product name: Recombinant human ITGAV protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 819-915 aa of BC136442 Sequence: SFSKAMLHLQWPYKYNNNTLLYILHYDIDGPMNCTSDMEINPLRIKISSLQTTEKNDTVAGQGERDHLITKRDLALSEGDIHTLGCGVAQCLKIVCQ Predict reactive species |
| Full Name | integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51) |
| Calculated Molecular Weight | 1048 aa, 116 kDa |
| Observed Molecular Weight | 130 kDa |
| GenBank Accession Number | BC136442 |
| Gene Symbol | Integrin alpha V |
| Gene ID (NCBI) | 3685 |
| RRID | AB_3084107 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Excitation Laser | Blue laser (488 nm) |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P06756 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. |
| IF protocol for CL Plus 488 Integrin Alpha V antibody CL488-27096 | Download protocol |
| Citations | - |
| Dilutions | IF/ICC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | CoraLite® Plus 488 |
Integrins are cell adhesion receptors that are heterodimers composed of non-covalently associated alpha and beta subunits. Integrin alpha V, also known as CD51, is a type I transmembrane glycoprotein composed of an extracellular domain, a transmembrane region and cytoplasmic domain (PMID: 2430295; 1690718). It can form heterodimers with one of the five beta integrin subunits (beta 1, 3, 5, 6, 8) that recognize ligands containing the sequence Arg-Gly-Asp, such as vitronectin, fibronectin, and osteopontin (PMID: 37087799). Integrin alpha V mainly plays a role in extracellular matrix-mediated cell adhesion and migration, differentiation, wound healing, inflammation, tumorigenesis, proliferation, angiogenesis, and metastasis. Protocols Product Specific Protocols IF protocol for CL Plus 488 Integrin Alpha V antibody CL488-27096 Download protocol Standard Protocols Click here to view our Standard Protocols
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
