KCNA6 Polyclonal antibody 31900-1-AP proteintech
$149.00
In stock
SKU
31900-1-AP
| Catalog Number | 31900-1-AP |
| Synonyms | HBK2, Human Brain Potassium Channel-2, Kv1.6, Potassium voltage-gated channel subfamily A member 6, PPP1R96 |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF-P, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | Daudi cells, Raji cells, Jurkat cells, TT cells, U2OS cells |
| Tested Applications — Positive IHC detected in | mouse brain tissue, rat brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF-P detected in | mouse cerebellum tissue |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:1000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Positive WB detected in | Daudi cells, Raji cells, Jurkat cells, TT cells, U2OS cells |
| Positive IHC detected in | mouse brain tissue, rat brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse cerebellum tissue |
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag35654 Product name: Recombinant human KCNA6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 194-262 aa of NM_002235.3 Sequence: ETLPQFRVDGRGGNNGGVSRVSPVSRGSQEEEEDEDDSYTFHHGITPGEMGTGGSSSLSTLGGSFFTDP Predict reactive species |
| Full Name | potassium voltage-gated channel, shaker-related subfamily, member 6 |
| Calculated Molecular Weight | 59 kDa，529aa |
| Observed Molecular Weight | 65 kDa |
| GenBank Accession Number | NM_002235.3 |
| Gene Symbol | KCNA6 |
| Gene ID (NCBI) | 3742 |
| RRID | AB_3670137 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | P17658 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for KCNA6 antibody 31900-1-AP | Download protocol |
| IHC protocol for KCNA6 antibody 31900-1-AP | Download protocol |
| WB protocol for KCNA6 antibody 31900-1-AP | Download protocol |
| human | WB Heart Rhythm Osimertinib induces prolongation of action potential duration via downregulation of KCNN1 expression: Exploring the potential mechanisms of arrhythmia. Authors - Xin Li View Article |
| Citations | 1 |
| Dilutions | WB : 1:500-1:1000 IHC : 1:50-1:500 IF-P : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
The Shaker-like Kv1 potassium channel family comprises 8 α subunits (Kv1.1-Kv1.8), which are key regulators of neuronal excitability in mammals (PMID: 7842011; 9581771; 22612818). Potassium voltage-gated channel subfamily A member 6 (KCNA6, also known as HBK2, Kv1.6, and PPP1R96) is a multi-pass membrane protein that is mainly expressed in the central and peripheral nervous system (PMID: 12042352; 8872310). The concentration of the Kv1.6 channel in the cell membrane can modulate the kinetic properties of Kv1.6-induced K+ current (PMID: 14575698). Protocols Product Specific Protocols IF protocol for KCNA6 antibody 31900-1-AP Download protocol IHC protocol for KCNA6 antibody 31900-1-AP Download protocol WB protocol for KCNA6 antibody 31900-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Osimertinib induces prolongation of action potential duration via downregulation of KCNN1 expression: Exploring the potential mechanisms of arrhythmia.
Journal: Heart Rhythm | Authors: Xin Li | Species: human | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
