KCNIP2 Recombinant monoclonal antibody 86696-1-RR proteintech
$149.00
In stock
SKU
86696-1-RR
| Catalog Number | 86696-1-RR |
| Synonyms | A-type potassium channel modulatory protein 2, Cardiac voltage-gated potassium channel modulatory subunit, KChIP2, Kv channel-interacting protein 2, Potassium channel-interacting protein 2 |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | mouse brain tissue, rat brain tissue |
| Recommended Dilutions — Western Blot (WB) | WB : 1:5000-1:50000 |
| Positive WB detected in | mouse brain tissue, rat brain tissue |
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Tested Reactivity | human, mouse, rat |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag14111 Product name: Recombinant human KCNIP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-70 aa of BC034685 Sequence: MRGQGRKESLSDSRDLDGSYDQLTGHPPGPTKKALKQRFLKLLPCCGPQALPSVSENSVDDEFELSTVCH Predict reactive species |
| Full Name | Kv channel interacting protein 2 |
| Calculated Molecular Weight | 270 aa, 31 kDa |
| Observed Molecular Weight | 31-35 kDa |
| GenBank Accession Number | BC034685 |
| Gene Symbol | KCNIP2 |
| Gene ID (NCBI) | 30819 |
| RRID | AB_3745060 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9NS61 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| WB protocol for KCNIP2 antibody 86696-1-RR | Download protocol |
| Citations | - |
| Dilutions | WB : 1:5000-1:50000 |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 251560C3 |
| Conjugation | Unconjugated |
KCNIP2 is a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified from this gene. Protocols Product Specific Protocols WB protocol for KCNIP2 antibody 86696-1-RR Download protocol Standard Protocols Click here to view our Standard Protocols
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
