KEAP1 Polyclonal antibody 10503-2-AP proteintech
$149.00
In stock
SKU
10503-2-AP
| Catalog Number | 10503-2-AP |
| Synonyms | KEAP 1, Kelch-like ECH-associated protein 1, KIAA0132, KLHL19 |
| Host | Rabbit |
| Reactivity | human, mouse and More (7) |
| Reactivity | human, mouse, rat, pig, monkey, chicken, zebrafish, hamster, yellow catfish |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA |
| Applications | WB, IHC, IF/ICC, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HEK-293 cells, HepG2 cells, Jurkat cells, MCF-7 cells, HeLa cells, MDA-MB-231 cells |
| Tested Applications — Positive IP detected in | mouse skeletal muscle tissue |
| Tested Applications — Positive IHC detected in | human lung cancer tissue, human breast cancer tissue, human skeletal muscle tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | U2OS cells, HepG2 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:5000-1:50000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Positive WB detected in | HEK-293 cells, HepG2 cells, Jurkat cells, MCF-7 cells, HeLa cells, MDA-MB-231 cells |
| Positive IP detected in | mouse skeletal muscle tissue |
| Positive IHC detected in | human lung cancer tissue, human breast cancer tissue, human skeletal muscle tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | U2OS cells, HepG2 cells |
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, pig, monkey, chicken, zebrafish, hamster, yellow catfish |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag0779 Product name: Recombinant human KEAP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 325-624 aa of BC002930 Sequence: GRLIYTAGGYFRQSLSYLEAYNPSDGTWLRLADLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGVIDGHIYAVGGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRLNSAECYYPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVETETWTFVAPMKHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMTSGRSGVGVAVTMEPCRKQIDQQNCTC Predict reactive species |
| Full Name | kelch-like ECH-associated protein 1 |
| Calculated Molecular Weight | 624 aa, 70 kDa |
| Observed Molecular Weight | 55~70 kDa |
| GenBank Accession Number | BC002930 |
| Gene Symbol | KEAP1 |
| Gene ID (NCBI) | 9817 |
| RRID | AB_2132625 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q14145 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for KEAP1 antibody 10503-2-AP | Download protocol |
| IHC protocol for KEAP1 antibody 10503-2-AP | Download protocol |
| IP protocol for KEAP1 antibody 10503-2-AP | Download protocol |
| WB protocol for KEAP1 antibody 10503-2-AP | Download protocol |
| human | WB J Hematol Oncol Modification of platinum sensitivity by KEAP1/NRF2 signals in non-small cell lung cancer. Authors - Yijun Tian View Article |
| Md Asad (Verified Customer) (02-24-2026) | Applications: Western Blot Primary Antibody Dilution: 1:1000 |
| Angie (Verified Customer) (07-06-2023) | The antibody was used at dilution of 1:10 000 incubated at room temperature for 1 hour followed by another hour of incubation with secondary antibody donkey-anti-rabbit (Alexa Fluor 800, 1:20 000). Applications: Western Blot Primary Antibody Dilution: 1:10 000 Cell Tissue Type: HeLa, MCF7 A375, MM415 KEAP1 Antibody Western Blot validation (1:10 000 dilution) in HeLa, MCF7 A375, MM415 (Cat no:10503-2-AP) |
| james (Verified Customer) (01-04-2021) | very good quick service Applications: Cell culture |
| Aurélie (Verified Customer) (09-01-2019) | Lysats from Mouse Cortex were loaded on 8% SDS-PAGE and immunobloted using anti-KEAP1 antibody (1/8000) over-night at 4°C. Applications: Western Blot, Primary Antibody Dilution: 1/8000 Cell Tissue Type: Mouse Cortex KEAP1 Antibody Western Blot, validation (1/8000 dilution) in Mouse Cortex (Cat no:10503-2-AP) |
| Mark (Verified Customer) (02-06-2019) | A doublet band appeared at the correct size and this was the only band that appeared on the blot. We did not perform genetic knockout/expression to confirm the specificity of this band, however it appears correct. Applications: Western Blot, Primary Antibody Dilution: 1:1000 Cell Tissue Type: Human breast cancer cells KEAP1 Antibody Western Blot, validation (1:1000 dilution) in Human breast cancer cells (Cat no:10503-2-AP) |
| Citations | 1045 |
| Dilutions | WB : 1:5000-1:50000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:50-1:500 IF/ICC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Kelch-like ECH-associated protein 1 (KEAP1) is a negative regulator of nuclear factor erythroid 2-related factor 2 (Nrf2), a transcription factor governing the antioxidant response. What is the molecular weight of KEAP1 protein? Are there any isoforms of KEAP1? The molecular weight of KEAP1 protein is 70 kDa. The KEAP1 gene gives rise only to protein isoforms, but mutations of KEAP1 protein have been found in various cancer types. What is the subcellular localization of KEAP1? KEAP1 resides in the cytoplasm, where it binds to Nrf2, targeting it for degradation and preventing translocation of Nrf2 to the nucleus. How does KEAP1 control Nrf2 levels? Is KEAP1 post-translationally modified? KEAP1 is rich in reactive cysteine residues, whose thiol groups play a role in binding to CUL3 and the polyubiquitination of Nrf2, which leads to degradation of Nrf2 via the proteasome system. During oxidative stress, electrophiles and reactive oxygen species (ROS) modify the KEAP1 thiol groups, reducing the affinity of KEAP1 to CUL3 and the stabilization of Nrf2. Nrf2 then translocates to the nucleus, where it binds to the antioxidant responsive elements (AREs) and induces the expression of antioxidant proteins (PMID: 16354693). How to measure oxidative stress using KEAP1 and Nrf2 proteins as a readout Under basal conditions (unstressed cells), a detectable KEAP1 protein level is observed. Oxidative stress modifies KEAP1 protein activity by increasing the Nrf2 protein levels. This can be measured, for example, using western blotting (PMID: 27697860). KEAP1 protein levels are not altered by oxidative stress. What is the role of the KEAP1-Nrf2 pathway in health and disease? The KEAP-Nrf2 pathway plays a vital role in redox homeostasis and cryoprotection. Inhibition of KEAP1 activity leads to the activation of Nrf2 and increase the response to oxidative stress and anti-inflammatory effects (PMID: 29717933). The activation of Nrf2 can be beneficial in the case of metabolic diseases, such as diabetes, as well as neurodegenerative diseases such as Parkinson's and Alzheimer's diseases. However, the increased activation of Nrf2 is also known to promote tumor growth and metastasis. Mutations in both KEAP1 and Nrf2 were found in various solid tumor types. Protocols Product Specific Protocols IF protocol for KEAP1 antibody 10503-2-AP Download protocol IHC protocol for KEAP1 antibody 10503-2-AP Download protocol IP protocol for KEAP1 antibody 10503-2-AP Download protocol WB protocol for KEAP1 antibody 10503-2-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Two stress-responsive kinases suppress ferroptosis by activating antioxidant programs under mild oxidative stress.
Journal: Signal Transduct Target Ther | Authors: Yumiko Fujikawa - p62/SQSTM1 Fuels Melanoma Progression by Opposing mRNA Decay of a Selective Set of Pro-metastatic Factors.
Journal: Cancer Cell | Authors: Panagiotis Karras | Species: human | Application: WB - iASPP Is an Antioxidative Factor and Drives Cancer Growth and Drug Resistance by Competing with Nrf2 for Keap1 Binding.
Journal: Cancer Cell | Authors: Wenjie Ge KD Validated | Species: human | Application: WB,IP - KEAP1 and STK11/LKB1 alterations enhance vulnerability to ATR inhibition in KRAS mutant non-small cell lung cancer
Journal: Cancer Cell | Authors: Ana Galan-Cobo | Species: human | Application: IF - KLHL22 activates amino-acid-dependent mTORC1 signalling to promote tumorigenesis and ageing.
Journal: Nature | Authors: Jie Chen KO Validated | Species: human | Application: WB - Modification of platinum sensitivity by KEAP1/NRF2 signals in non-small cell lung cancer.
Journal: J Hematol Oncol | Authors: Yijun Tian | Species: human | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
