RAF1 Recombinant monoclonal antibody 84994-4-RR proteintech
$149.00
In stock
SKU
84994-4-RR
| Catalog Number | 84994-4-RR |
| Synonyms | 242540A2, c Raf, CRAF, EC:2.7.11.1, NS5 |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HCT 116 cells, K-562 cells, HeLa cells, DU 145 cells, NIH/3T3 cells, PC-12 cells, RAW 264.7 cells |
| Tested Applications — Positive IP detected in | HeLa cells |
| Tested Applications — Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HeLa cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:5000-1:50000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Positive WB detected in | HCT 116 cells, K-562 cells, HeLa cells, DU 145 cells, NIH/3T3 cells, PC-12 cells, RAW 264.7 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag25423 Product name: Recombinant human RAF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-59 aa of BC018119 Sequence: MEHIQGAWKTISNGFGFKDAVFDGSSCISPTIVQQFGYQRRASDDGKLTDPSKTSNTIR Predict reactive species |
| Full Name | v-raf-1 murine leukemia viral oncogene homolog 1 |
| Calculated Molecular Weight | 648 aa, 73 kDa |
| Observed Molecular Weight | ~75 kDa |
| GenBank Accession Number | BC018119 |
| Gene Symbol | RAF1 |
| Gene ID (NCBI) | 5894 |
| RRID | AB_3743920 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P04049 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for RAF1 antibody 84994-4-RR | Download protocol |
| IHC protocol for RAF1 antibody 84994-4-RR | Download protocol |
| IP protocol for RAF1 antibody 84994-4-RR | Download protocol |
| WB protocol for RAF1 antibody 84994-4-RR | Download protocol |
| human | WB Chem Biodivers 3-Deoxy-3β-syringoylamino-betulinic acid Reduces Breast Tumor Growth and Lung Colonization, With Associated Downregulation of the RAS/RAF/MEK/ERK Pathway. Authors - Hu Liu View Article |
| mouse | WB Stem Cell Res Ther Rg1-preconditioned adipose-derived mesenchymal stromal cells alleviate colitis via exosome-mediated Inhibition of macrophage glycolysis through RAS signaling. Authors - Yuan Fang View Article |
| Citations | 3 |
| Dilutions | WB : 1:5000-1:50000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:500-1:2000 IF/ICC : 1:200-1:800 |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 242540A2 |
| Conjugation | Unconjugated |
Raf-1 proto-oncogene, serine/threonine kinase(RAF1), is a MAP kinase kinase kinase (MAP3K), which functions downstream of the Ras family of membrane associated GTPases to which it binds directly. RAF1 has two isoforms with MW of 73, 75 kDa. RAF1 plays an important role in the control of gene expression involved in the cell division cycle, apoptosis, cell differentiation and cell migration. Protocols Product Specific Protocols IF protocol for RAF1 antibody 84994-4-RR Download protocol IHC protocol for RAF1 antibody 84994-4-RR Download protocol IP protocol for RAF1 antibody 84994-4-RR Download protocol WB protocol for RAF1 antibody 84994-4-RR Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- 3-Deoxy-3β-syringoylamino-betulinic acid Reduces Breast Tumor Growth and Lung Colonization, With Associated Downregulation of the RAS/RAF/MEK/ERK Pathway.
Journal: Chem Biodivers | Authors: Hu Liu | Species: human | Application: WB - Extracellular Vesicles Derived from Resveratrol-Treated BMSCs Promote the Repair of Bone Defects in Osteoporotic Rats.
Journal: Stem Cell Rev Rep | Authors: Yan Lv - Rg1-preconditioned adipose-derived mesenchymal stromal cells alleviate colitis via exosome-mediated Inhibition of macrophage glycolysis through RAS signaling.
Journal: Stem Cell Res Ther | Authors: Yuan Fang | Species: mouse | Application: WB
Reviews
Write Your Own Review