CoraLite® Plus 488-conjugated Ki-67 Polyclonal antibody CL488-27309 proteintech
$479.00
In stock
SKU
CL488-27309
| Catalog Number | CL488-27309 |
| Synonyms | MKI67, KI67, Proliferation marker protein Ki-67, Ki 67, Antigen KI-67 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Proclin300, BSA, Glycerol |
| Applications | IF/ICC, FC (Intra) |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive IF/ICC detected in | HeLa cells |
| Tested Applications — Positive FC (Intra) detected in | Ramos cells, HeLa cells |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Recommended Dilutions — Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | Ramos cells, HeLa cells |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension |
| Tested Reactivity | human |
| Cited Reactivity | human |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag26266 Product name: Recombinant human KI67 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1201-1300 aa of NM_002417 Sequence: AGTLPGSKRQLQTPKEKAQALEDLAGFKELFQTPGHTEELVAAGKTTKIPCDSPQSDPVDTPTSTKQRPKRSIRKADVEGELLACRNLMPSAGKAMHTPK Predict reactive species |
| Full Name | antigen identified by monoclonal antibody Ki-67 |
| Calculated Molecular Weight | 359 kDa |
| GenBank Accession Number | NM_002417 |
| Gene Symbol | KI67 |
| Gene ID (NCBI) | 4288 |
| RRID | AB_2919213 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Excitation Laser | Blue laser (488 nm) |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P46013 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. |
| FC protocol for CL Plus 488 Ki-67 antibody CL488-27309 | Download protocol |
| IF protocol for CL Plus 488 Ki-67 antibody CL488-27309 | Download protocol |
| human | IF Cell Rep MIAT-DHX9 spatiotemporal expression drives venous neointimal hyperplasia through nucleolar homeostasis and mitotic progression. Authors - Yue Lou View Article |
| Shriya (Verified Customer) (10-04-2025) | CoraLite® Plus 488-conjugated Ki-67 Polyclonal antibody Applications: Immunofluorescence Cell Tissue Type: human |
| Citations | 3 |
| Dilutions | IF/ICC : 1:50-1:500 FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | CoraLite® Plus 488 |
The Ki-67 protein (also known as MKI67) is a cellular marker for proliferation. Ki67 is present during all active phases of the cell cycle (G1, S, G2 and M), but is absent in resting cells (G0). Cellular content of Ki-67 protein markedly increases during cell progression through S phase of the cell cycle. Therefore, the nuclear expression of Ki67 can be evaluated to assess tumor proliferation by immunohistochemistry. It has been demonstrated to be of prognostic value in breast cancer. In head and neck cancer, several studies have reported an association between high proliferative activity and poorer prognosis. Protocols Product Specific Protocols FC protocol for CL Plus 488 Ki-67 antibody CL488-27309 Download protocol IF protocol for CL Plus 488 Ki-67 antibody CL488-27309 Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- LncRNA LINC01703 promotes the proliferation, migration, and invasion of colorectal cancer by activating PI3K/AKT pathway
Journal: J Biochem Mol Toxicol | Authors: Yuanhui Xu | Species: human | Application: IF - Bidirectional effects of the tryptophan metabolite indole-3-acetaldehyde on colorectal cancer
Journal: World J Gastrointest Oncol | Authors: Ze Dai | Species: human | Application: IF - MIAT-DHX9 spatiotemporal expression drives venous neointimal hyperplasia through nucleolar homeostasis and mitotic progression.
Journal: Cell Rep | Authors: Yue Lou | Species: human | Application: IF
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
