KIF15 Recombinant monoclonal antibody 82903-1-RR proteintech
$149.00
In stock
SKU
82903-1-RR
| Catalog Number | 82903-1-RR |
| Synonyms | 230049F1, hKLP2, Kinesin-like protein 2, Kinesin-like protein 7, Kinesin-like protein KIF15 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HEK-293 cells, HeLa cells, HepG2 cells, K-562 cells |
| Tested Applications — Positive IHC detected in | human intrahepatic cholangiocarcinoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:2000-1:10000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Positive WB detected in | HEK-293 cells, HeLa cells, HepG2 cells, K-562 cells |
| Positive IHC detected in | human intrahepatic cholangiocarcinoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag33897 Product name: Recombinant human KIF15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 950-1050 aa of NM_020242 Sequence: EQQMAKVQKLEESLLATEKVISSLEKSRDSDKKVVADLMNQIQELRTSVCEKTETIDTLKQELKDINCKYNSALVDREESRVLIKKQEVDILDLKETLRLR Predict reactive species |
| Full Name | kinesin family member 15 |
| Calculated Molecular Weight | 160 kDa |
| Observed Molecular Weight | 160 kDa |
| GenBank Accession Number | NM_020242 |
| Gene Symbol | KIF15 |
| Gene ID (NCBI) | 56992 |
| RRID | AB_3670632 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9NS87 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for KIF15 antibody 82903-1-RR | Download protocol |
| WB protocol for KIF15 antibody 82903-1-RR | Download protocol |
| Citations | - |
| Dilutions | WB : 1:2000-1:10000 IHC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 230049F1 |
| Conjugation | Unconjugated |
KIF15, also named as KLP2 and KNSL7, belongs to the kinesin-like protein family and KLP2 subfamily. It is a plus-end directed kinesin-like motor enzyme which involved in mitotic spindle assembly. Several isoforms of KIF15 exist due to the alternative splicing, with molecular weight between 130-160 kDa. Sometimes higher molecular weight around 200 kDa can also be observed, which may be a modified variant of KIF15. (14618103) Protocols Product Specific Protocols IHC protocol for KIF15 antibody 82903-1-RR Download protocol WB protocol for KIF15 antibody 82903-1-RR Download protocol Standard Protocols Click here to view our Standard Protocols
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
