Cytokeratin 17 Polyclonal antibody 22230-1-AP proteintech
$149.00
In stock
SKU
22230-1-AP
| Catalog Number | 22230-1-AP |
| Synonyms | KRT17, Keratin-17, keratin 17, Cytokeratin-17, Cytokeratin,Keratin |
| Host | Rabbit |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HeLa cells, MCF-7 cells |
| Tested Applications — Positive IHC detected in | human bowen disease, human cervical cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HeLa cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:4000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
| Positive WB detected in | HeLa cells, MCF-7 cells |
| Positive IHC detected in | human bowen disease, human cervical cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
| Tested Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag17575 Product name: Recombinant human KRT17 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-87 aa of BC000159 Sequence: MTTSIRQFTSSSSIKGSSGLGGGSSRTSCRLSGGLGAGSCRLGSAGGLGSTLGGSSYSSCYSFGSGGGYGSSFGGVDGLLAGGEKAT Predict reactive species |
| Full Name | keratin 17 |
| Calculated Molecular Weight | 432 aa, 48 kDa |
| Observed Molecular Weight | 48 kDa |
| GenBank Accession Number | BC000159 |
| Gene Symbol | Cytokeratin 17 |
| Gene ID (NCBI) | 3872 |
| RRID | AB_2879040 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q04695 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for Cytokeratin 17 antibody 22230-1-AP | Download protocol |
| IHC protocol for Cytokeratin 17 antibody 22230-1-AP | Download protocol |
| WB protocol for Cytokeratin 17 antibody 22230-1-AP | Download protocol |
| Citations | - |
| Dilutions | WB : 1:1000-1:4000 IHC : 1:200-1:800 IF/ICC : 1:20-1:200 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Keratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells, which are classified into two major sequence types. Type I keratins are a group of acidic intermediate filament proteins, including K9-K23, and the hair keratins Ha1-Ha8. Type II keratins are the basic or neutral courterparts to the acidic type I keratins, including K1-K8, and the hair keratins, Hb1-Hb6. Keratin 17 is a type I cytokeratin. It is found in nail beds, hair follicles, sebaceous glands, and other epidermal appendages. It is used as a marker for trauma. Protocols Product Specific Protocols IF protocol for Cytokeratin 17 antibody 22230-1-AP Download protocol IHC protocol for Cytokeratin 17 antibody 22230-1-AP Download protocol WB protocol for Cytokeratin 17 antibody 22230-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
