Cytokeratin 80 Polyclonal antibody 16835-1-AP proteintech
$149.00
In stock
SKU
16835-1-AP
| Catalog Number | 16835-1-AP |
| Synonyms | KRT80, CK 80, CK-80, Cytokeratin-80, K80 |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF, IP, ELISA |
| Applications | WB, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | NIH/3T3 cells, human skeletal muscle tissue |
| Tested Applications — Positive IHC detected in | human skin cancer tissue, human bowen disease tissue, human colon cancer, human colon cancer tissue, mouse skin tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:3600 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Positive WB detected in | NIH/3T3 cells, human skeletal muscle tissue |
| Positive IHC detected in | human skin cancer tissue, human bowen disease tissue, human colon cancer, human colon cancer tissue, mouse skin tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:500-1:3600 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag10498 Product name: Recombinant human KRT80 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-422 aa of BC065180 Sequence: MACRSCVVGFSSLSSCEVTPVGSPRPGTSGWDSCRAPGPGFSSRSLTGCWSAGTISKVTVNPGLLVPLDVKLDPAVQQLKNQEKEEMKALNDKFASLIGKVQALEQRNQLLETRWSFLQGQDSAIFDLGHLYEEYQGRLQEELRKVSQERGQLEANLLQVLEKVEEFRIRYEDEISKRTDMEFTFVQLKKDLDAECLHRTELETKLKSLESFVELMKTIYEQELKDLAAQVKDVSVTVGMDSRCHIDLSGIVEEVKAQYDAVAARSLEEAEAYSRSQLEEQAARSAEYGSSLQSSRSEIADLNVRIQKLRSQILSVKSHCLKLEENIKTAEEQGELAFQDAKTKLAQLEAALQQAKQDMARQLRKYQELMNVKLALDIEIATYRKLVEGEEGRMDSPSATVVSAVQSRCKTAPSLPYPLCSL Predict reactive species |
| Full Name | keratin 80 |
| Calculated Molecular Weight | 422 aa, 47 kDa |
| Observed Molecular Weight | 47 kDa, 50 kDa |
| GenBank Accession Number | BC065180 |
| Gene Symbol | KRT80 |
| Gene ID (NCBI) | 144501 |
| RRID | AB_1851273 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q6KB66 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for Cytokeratin 80 antibody 16835-1-AP | Download protocol |
| WB protocol for Cytokeratin 80 antibody 16835-1-AP | Download protocol |
| human | WB Cell Cycle MiR-4268 suppresses gastric cancer genesis through inhibiting keratin 80. Authors - Fan Zhang KD Validated View Article |
| Citations | 22 |
| Dilutions | WB : 1:500-1:3600 IHC : 1:200-1:800 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
KRT80 is a human IF type II epithelial keratin gene involved in the formation of IF heterodimers in various epithelial cells. KRT80 is overexpressed in many neoplasms and plays an essential role in promoting cell proliferation, migration and invasiveness, and is associated with poor prognosis in cancer patients. KRT80 has three isoforms with predicted MW of 50 kDa, 47 kDa, and 54 kDa. Protocols Product Specific Protocols IHC protocol for Cytokeratin 80 antibody 16835-1-AP Download protocol WB protocol for Cytokeratin 80 antibody 16835-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Direct epitranscriptomic regulation of mammalian translation initiation through N4-acetylcytidine.
Journal: Mol Cell | Authors: Daniel Arango | Species: human | Application: WB - Single-cell atlas of keratoconus corneas revealed aberrant transcriptional signatures and implicated mechanical stretch as a trigger for keratoconus pathogenesis.
Journal: Cell Discov | Authors: Shengqian Dou | Species: human | Application: IHC - Keratin Profiling by Single-Cell RNA-Sequencing Identifies Human Prostate Stem Cell Lineage Hierarchy and Cancer Stem-Like Cells.
Journal: Int J Mol Sci | Authors: Wen-Yang Hu | Species: human | Application: IF - Keratin 80 promotes migration and invasion of colorectal carcinoma by interacting with PRKDC via activating the AKT pathway.
Journal: Cell Death Dis | Authors: Changcan Li | Species: human | Application: WB,IF - MiR-4268 suppresses gastric cancer genesis through inhibiting keratin 80.
Journal: Cell Cycle | Authors: Fan Zhang KD Validated | Species: human | Application: WB - Consequences of plectin ablation on the various intermediate filament systems in skeletal muscle
Journal: Eur J Cell Biol | Authors: Marta Rocha - The facilitating effects of KRT80 on chemoresistance, lipogenesis, and invasion of esophageal cancer
Journal: Cancer Biol Ther | Authors: Wen-Jing Yun | Species: human | Application: WB,IHC - Keratin Profiling by Single-Cell RNA-Sequencing Identifies Human Prostate Stem Cell Lineage Hierarchy and Cancer Stem-Like Cells.
Journal: Int J Mol Sci | Authors: Wen-Yang Hu | Species: human | Application: IF - Keratin 80 as a diagnostic biomarker with limited prognostic value in non-small cell lung cancer
Journal: Sci Rep | Authors: Ying Zeng | Application: IHC - miR-195-5p Suppresses KRT80 Expression Inducing Cell Cycle Arrest in Colon Cancer
Journal: Cancers (Basel) | Authors: Emanuele Piccinno | Species: mouse | Application: IF - Discovery of non-genomic drivers of YAP signaling modulating the cell plasticity in CRC tumor lines
Journal: iScience | Authors: Nobuhiko Ogasawara | Species: human | Application: IF - Consequences of plectin ablation on the various intermediate filament systems in skeletal muscle
Journal: Eur J Cell Biol | Authors: Marta Rocha - The BET PROTAC inhibitor GNE-987 displays anti-tumor effects by targeting super-enhancers regulated gene in osteosarcoma
Journal: BMC Cancer | Authors: Di Wu | Species: human | Application: WB - MiR-4268 suppresses gastric cancer genesis through inhibiting keratin 80.
Journal: Cell Cycle | Authors: Fan Zhang | Species: human | Application: WB - Sequencing and Bioinformatics analysis of lncRNA/circRNA-miRNA-mRNA in Glioblastoma multiforme
Journal: Metab Brain Dis | Authors: Renjie Wang | Species: human | Application: WB - Tandem mass tag (TMT) quantitative protein analysis-based proteomics and parallel reaction monitoring (PRM) validation revealed that MST4 accelerates osteosarcoma proliferation by increasing MRC2 activity
Journal: Mol Carcinog | Authors: Yunyan Liu | Species: human | Application: IHC - Keratin 80 regulated by miR-206/ETS1 promotes tumor progression via the MEK/ERK pathway in ovarian cancer.
Journal: J Cancer | Authors: Ouxuan Liu | Species: human | Application: WB,IHC - KRT80 Promotes Lung Adenocarcinoma Progression and Serves as a Substrate for VCP
Journal: J Cancer | Authors: Shanhua Huang | Species: human | Application: WB,IP,IHC - KRT80 in hepatocellular carcinoma plays oncogenic role via epithelial-mesenchymal transition and PI3K/AKT pathway
Journal: IUBMB Life | Authors: Ruheng Hua | Species: human | Application: WB,IHC - Keratin 80 serves as a potential biomarker in metastatic breast cancer.
Journal: Discov Oncol | Authors: Feng Sun | Species: human | Application: WB - KRT80 expression works as a biomarker and a target for differentiation in gastric cancer
Journal: Histol Histopathol | Authors: Kai-Hang Shi | Species: human | Application: WB,IHC - Small interfering RNA-mediated knockdown of KRT80 suppresses colorectal cancer proliferation.
Journal: Exp Ther Med | Authors: Jiatian Lin | Species: human | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
