L2HGDH Polyclonal antibody 15707-1-AP proteintech
$149.00
In stock
SKU
15707-1-AP
| Catalog Number | 15707-1-AP |
| Synonyms | C14orf160, DURANIN, L2HGDH |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | A549 cells, rat brain tissue, mouse small intestine tissue, SGC-7901 cells, MCF-7 cells |
| Tested Applications — Positive IHC detected in | human liver cancer tissue, human gliomas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:3000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Positive WB detected in | A549 cells, rat brain tissue, mouse small intestine tissue, SGC-7901 cells, MCF-7 cells |
| Positive IHC detected in | human liver cancer tissue, human gliomas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:1000-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag8382 Product name: Recombinant human L2HGDH protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-351 aa of BC006117 Sequence: MVPALRYLVGACGRARGRFAGGSPGACGFASGRPRPLCGGSRSASTSSFDIVIVGGGIVGLASARALILRHPSLSIGVLEKEKDLAVHQTGHNSGVIHSGIYYKPESLKAKLCVQGAALLYEYCQQKGISYKQCGKLIVAVEQEEIPRLQALYEKGLQNGVPGLRLIQQEDIKKKEPYCRGLMAIDCPHTGIVDYRQVALSFAQDFQEAGGSVLTNFEVKGIEMAKESPSRSIDGMQYPIVIKNTKGEEIRCQYVVTCAGLYSDRISELSGCTPDPRIVPFRGDYLLLKPEKCYLVKGNIYPVPDSRFPFLGVHFTPRMDGSIWLGPNAVLAFKREGYRPFDFSATDVMDI Predict reactive species |
| Full Name | L-2-hydroxyglutarate dehydrogenase |
| Calculated Molecular Weight | 463aa,50 kDa; 441aa,49 kDa |
| Observed Molecular Weight | 45 kDa |
| GenBank Accession Number | BC006117 |
| Gene Symbol | L2HGDH |
| Gene ID (NCBI) | 79944 |
| RRID | AB_2133202 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9H9P8 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for L2HGDH antibody 15707-1-AP | Download protocol |
| WB protocol for L2HGDH antibody 15707-1-AP | Download protocol |
| human | WB Cell Chem Biol MYC Regulation of D2HGDH and L2HGDH Influences the Epigenome and Epitranscriptome. Authors - ZhiJun Qiu KO Validated View Article |
| Anirban (Verified Customer) (12-05-2021) | 24 ug protein/lane. One non specific band observed above the KD band. 5% milk was used to block (1 hr incubation) and in secondary Ab (1/5000 dilution-45 minutes incubation). Primary Ab was diluted in 3% BSA (1.5 hrs incubation. All were done in TBST (0.1% Tween 20). Nitrocellulose membrane was used. Applications: Western Blot Primary Antibody Dilution: 1/1000 Cell Tissue Type: Renca (mouse renal cancer cell line) L2HGDH Antibody Western Blot validation (1/1000 dilution) in Renca (mouse renal cancer cell line) (Cat no:15707-1-AP) |
| Daniel (Verified Customer) (09-30-2019) | Tissue was boiled in SDS-sample buffer and separated by size on an SDS-PAGE. Applications: Western Blot, Primary Antibody Dilution: 1:1000 Cell Tissue Type: Mouse liver L2HGDH Antibody Western Blot, validation (1:1000 dilution) in Mouse liver (Cat no:15707-1-AP) |
| Citations | 19 |
| Dilutions | WB : 1:1000-1:3000 IHC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
L2HGDH(L-2-hydroxyglutarate dehydrogenase, mitochondrial) is also named as duranin, C14orf160 and belongs to the L2HGDH family. The putative L2HGDH is predicted to be targeted to the mitochondria where its mitochondrial targeting sequence is presumably removed(PMID:16005139). Defects in L2HGDH are the cause of L-2-hydroxyglutaric aciduria (L2HGA). It has 2 isoforms produced by alternative splicing with the molecular weight of 50 kDa and 48 kDa. L2HGDH also can be detected as ~45kD due to the 51aa transit peptide cleaved. Protocols Product Specific Protocols IHC protocol for L2HGDH antibody 15707-1-AP Download protocol WB protocol for L2HGDH antibody 15707-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Hypoxia Induces Production of L-2-Hydroxyglutarate.
Journal: Cell Metab | Authors: Andrew M Intlekofer KD Validated | Species: human | Application: WB - Hypoxia-Mediated Increases in L-2-hydroxyglutarate Coordinate the Metabolic Response to Reductive Stress.
Journal: Cell Metab | Authors: William M Oldham KD Validated | Species: human | Application: WB - 2-Hydroxyglutarate produced by neomorphic IDH mutations suppresses homologous recombination and induces PARP inhibitor sensitivity.
Journal: Sci Transl Med | Authors: Parker L Sulkowski KD Validated | Species: human | Application: WB - Lipoylation inhibition enhances radiation control of lung cancer by suppressing homologous recombination DNA damage repair
Journal: Sci Adv | Authors: Jui-Chung Chiang | Species: human | Application: WB - L-2-Hydroxyglutarate: an epigenetic modifier and putative oncometabolite in renal cancer.
Journal: Cancer Discov | Authors: Eun-Hee Shim | Species: human | Application: WB - MYC Regulation of D2HGDH and L2HGDH Influences the Epigenome and Epitranscriptome.
Journal: Cell Chem Biol | Authors: ZhiJun Qiu KO Validated | Species: human | Application: WB - Lipoylation inhibition enhances radiation control of lung cancer by suppressing homologous recombination DNA damage repair
Journal: Sci Adv | Authors: Jui-Chung Chiang | Species: human | Application: WB - Biochemical and Epigenetic Insights into L-2-Hydroxyglutarate, a Potential Therapeutic Target in Renal Cancer.
Journal: Clin Cancer Res | Authors: Sandeep Shelar - L-2hydroxyglutaric acid rewires amino acid metabolism in colorectal cancer via the mTOR-ATF4 axis
Journal: Oncogene | Authors: Sho Tabata | Species: human | Application: WB - MYC Regulation of D2HGDH and L2HGDH Influences the Epigenome and Epitranscriptome.
Journal: Cell Chem Biol | Authors: ZhiJun Qiu | Species: human | Application: WB - MYC, mitochondrial metabolism and O-GlcNAcylation converge to modulate the activity and subcellular localization of DNA and RNA demethylases.
Journal: Leukemia | Authors: An-Ping Lin | Species: human | Application: WB - Blockage of L2HGDH-mediated S-2HG catabolism orchestrates macrophage polarization to elicit antitumor immunity
Journal: Cell Rep | Authors: Shuang Feng | Species: mouse - D-2-hydroxyglutarate is essential for maintaining oncogenic property of mutant IDH-containing cancer cells but dispensable for cell growth.
Journal: Oncotarget | Authors: Shenghong Ma | Application: WB - Renal oncometabolite L-2-hydroxyglutarate imposes a block in kidney tubulogenesis: Evidence for an epigenetic basis for the L-2HG-induced impairment of differentiation
Journal: Front Endocrinol (Lausanne) | Authors: Mary Taub | Application: WB - Urinary 2-Hydroxyglutarate Enantiomers Are Markedly Elevated in a Murine Model of Type 2 Diabetic Kidney Disease.
Journal: Metabolites | Authors: Judy Baek | Species: mouse | Application: WB - l-2-Hydroxyglutarate contributes to tumor radioresistance through regulating the hypoxia-inducible factor-1α signaling pathway
Journal: J Cell Physiol | Authors: Manman Zhang | Species: human | Application: WB - L2hgdh deficiency accumulates L-2-hydroxyglutarate with progressive leukoencephalopathy and neurodegeneration.
Journal: Mol Cell Biol | Authors: Shenghong Ma | Species: mouse | Application: WB - Screen for IDH1, IDH2, IDH3, D2HGDH and L2HGDH mutations in glioblastoma.
Journal: PLoS One | Authors: Krell Daniel D | Species: human | Application: IHC - Hypoxia-inducible factors drive miRNA-mediated downregulation of L2HGDH and HIF1A in clear cell renal cancer independent of 14q deletion.
Journal: bioRxiv | Authors: Soma Seal | Species: human, mouse | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
