TMEM126A Recombinant monoclonal antibody 83440-2-RR proteintech
$149.00
In stock
SKU
83440-2-RR
| Catalog Number | 83440-2-RR |
| Synonyms | 240425A11, OPA7, TMEM, TMEM126 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IF/ICC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | T-47D cells, HeLa cells, MCF-7 cells, U-251 cells, U2OS cells, human placenta tissue |
| Tested Applications — Positive IF/ICC detected in | HeLa cells |
| Tested Applications — Positive FC (Intra) detected in | HeLa cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:2000-1:10000 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:500-1:2000 |
| Recommended Dilutions — Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| Positive WB detected in | T-47D cells, HeLa cells, MCF-7 cells, U-251 cells, U2OS cells, human placenta tissue |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | HeLa cells |
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:500-1:2000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag14705 Product name: Recombinant human TMEM126A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 67-195 aa of BC007875 Sequence: AGLPMAGIPFLTTDLTYRCFVSFPLNTGDLDCETCTITRSGLTGLVIGGLYPVFLAIPVNGGLAARYQSALLPHKGNILSYWIRTSKPVFRKMLFPILLQTMFSAYLGSEQYKLLIKALQLSEPGKEIH Predict reactive species |
| Full Name | transmembrane protein 126A |
| Calculated Molecular Weight | 195 aa, 22 kDa |
| Observed Molecular Weight | 20-25 kDa |
| GenBank Accession Number | BC007875 |
| Gene Symbol | TMEM126A |
| Gene ID (NCBI) | 84233 |
| RRID | AB_3671081 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9H061 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| FC protocol for TMEM126A antibody 83440-2-RR | Download protocol |
| IF protocol for TMEM126A antibody 83440-2-RR | Download protocol |
| WB protocol for TMEM126A antibody 83440-2-RR | Download protocol |
| Aditya (Verified Customer) (06-16-2025) | did not get any bands in the region specified by proteintech (hek lysate), cut the blot for this, so may have been banding above or below that i didnt see Applications: Western Blot Primary Antibody Dilution: 1:1000 |
| Citations | - |
| Dilutions | WB : 1:2000-1:10000 IF/ICC : 1:500-1:2000 FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 240425A11 |
| Conjugation | Unconjugated |
TMEM126A is a mitochondrial inner membrane protein that is enriched in the cristae. TMEM126A is necessary for Complex I assembly or stability.Complex I (CI) is the largest enzyme of the mitochondrial respiratory chain, and its defects are the main cause of mitochondrial disease. Protocols Product Specific Protocols FC protocol for TMEM126A antibody 83440-2-RR Download protocol IF protocol for TMEM126A antibody 83440-2-RR Download protocol WB protocol for TMEM126A antibody 83440-2-RR Download protocol Standard Protocols Click here to view our Standard Protocols
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
