| Catalog Number | CL594-67220 |
| Synonyms | CD305, hLAIR1, LAIR 1, LAIR1 |
| Host | Mouse |
| Reactivity | Human |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Proclin300, BSA, Glycerol |
| Applications | IF-P |
| Host / Isotype | Mouse / IgG2a |
| Tested Applications — Positive IF-P detected in | human tonsillitis tissue |
| Recommended Dilutions — Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Positive IF-P detected in | human tonsillitis tissue |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Tested Reactivity | Human |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag14459 Product name: Recombinant human LAIR1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 184-287 aa of BC027899 Sequence: FCLHRQNQIKQGPPRSKDEEQKPQQRPDLAVDVLERTADKATVNGLPEKDRETDTSALAAGSSQEVTYAQLDHWALTQRTARAVSPQSTKPMAESITYAAVARH Predict reactive species |
| Full Name | leukocyte-associated immunoglobulin-like receptor 1 |
| Calculated Molecular Weight | 287 aa, 31 kDa |
| GenBank Accession Number | BC027899 |
| Gene Symbol | LAIR1 |
| Gene ID (NCBI) | 3903 |
| RRID | AB_2920100 |
| Conjugate | CoraLite®594 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 588 nm / 604 nm |
| Excitation Laser | Yellow-Green Laser (561 nm) |
| Purification Method | Protein A purification |
| UNIPROT ID | Q6GTX8 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. |
| IF protocol for CL594 LAIR1 antibody CL594-67220 | Download protocol |
| Citations | - |
| Dilutions | IF-P : 1:50-1:500 |
| Isotype | IgG2a |
| Clonality | Monoclonal |
| Clone Number | 1A5D1 |
| Conjugation | CoraLite®594 |
Leukocyte-associated immunoglobulin-like receptor 1 (LAIR1) is a transmembrane glycoprotein with a single immunoglobulin-like domain and a cytoplasmic tail containing two immune receptor tyrosine-based inhibitory motifs (PMID: 9285412). LAIR1 is expressed on the majority of human PBMCs, including NK, T, B, monocytes, and dendritic cells, as well as the majority of thymocytes (PMID: 10229813). It functions as an inhibitory receptor that plays a constitutive negative regulatory role on cytolytic function of NK cells, B cells and T cells. LAIR1 is a collagen receptor (PMID: 16754721). Tumor-expressed collagens can modulate immune cell function through the inhibitory collagen receptor LAIR1 (PMID: 21955987). Protocols Product Specific Protocols IF protocol for CL594 LAIR1 antibody CL594-67220 Download protocol Standard Protocols Click here to view our Standard Protocols
Product Documents