CoraLite® Plus 488-conjugated LASP1 Monoclonal antibody CL488-68080 proteintech
$479.00
In stock
SKU
CL488-68080
| Catalog Number | CL488-68080 |
| Synonyms | 1G4B6, LASP-1, LIM and SH3 protein 1, MLN50 |
| Host | Mouse |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Proclin300, BSA, Glycerol |
| Applications | IF/ICC, FC (Intra) |
| Host / Isotype | Mouse / IgG1 |
| Tested Applications — Positive IF/ICC detected in | A549 cells |
| Tested Applications — Positive FC (Intra) detected in | A549 cells |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Recommended Dilutions — Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| Positive IF/ICC detected in | A549 cells |
| Positive FC (Intra) detected in | A549 cells |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| Tested Reactivity | human |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag18101 Product name: Recombinant human LASP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 125-210 aa of BC012460 Sequence: EFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVSIQRSAPGGGGKRYRAA Predict reactive species |
| Full Name | LIM and SH3 protein 1 |
| Calculated Molecular Weight | 30 kDa |
| Observed Molecular Weight | 35-38 kDa |
| GenBank Accession Number | BC012460 |
| Gene Symbol | LASP1 |
| Gene ID (NCBI) | 3927 |
| ENSEMBL Gene ID | ENSG00000002834 |
| RRID | AB_2934619 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Excitation Laser | Blue laser (488 nm) |
| Purification Method | Protein G purification |
| UNIPROT ID | Q14847 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. |
| FC protocol for CL Plus 488 LASP1 antibody CL488-68080 | Download protocol |
| IF protocol for CL Plus 488 LASP1 antibody CL488-68080 | Download protocol |
| Citations | - |
| Dilutions | IF/ICC : 1:50-1:500 FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Clone Number | 1G4B6 |
| Conjugation | CoraLite® Plus 488 |
LASP1(LIM and SH3 protein 1), also known as MLN50, is a 261 amino acid protein that localizes to both the cytoplasm and the cytoskeleton(PMID: 7589475). LASP1 consists of an N-terminal LIM-domain with two zinc finger motifs, followed by two central actin-binding nebulin repeats, flanked by a linker region and a C-terminal SH3 domain (PMID: 17177073, 9848085). LASP-1 interacts with F-Actin and plays an important role in the regulation of Actin-associated cytoskeletal organization. Agonist-dependent changes in LASP1 phosphorylation may regulate Actin-related ion transport activities in epithelial cells (PMID: 15465019,12571245). Overexpression of LASP-1 is associated with breast cancer, and plays a role in tumor transformation and metastasis (PMID: 17956604). Protocols Product Specific Protocols FC protocol for CL Plus 488 LASP1 antibody CL488-68080 Download protocol IF protocol for CL Plus 488 LASP1 antibody CL488-68080 Download protocol Standard Protocols Click here to view our Standard Protocols
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
