LCN12 Polyclonal antibody 28004-1-AP proteintech
$149.00
In stock
SKU
28004-1-AP
| Catalog Number | 28004-1-AP |
| Synonyms | lipocalin 12 |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | mouse testis tissue, rat kidney tissue, rat testis tissue |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:8000 |
| Positive WB detected in | mouse testis tissue, rat kidney tissue, rat testis tissue |
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Tested Reactivity | human, mouse, rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag27402 Product name: Recombinant human LCN12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 51-177 aa of BC041168 Sequence: NSFRPEHRALLNAFTATFELSDDGRFEVWNAMTRGQHCDTWSYVLIPAAQPGQFTVDHGVEPGADREETRVVDSDYTQFALMLSRRHTSRLAVLRISLLGRSWLLPPGTLDQFICLGRAQGLSDDNI Predict reactive species |
| Full Name | lipocalin 12 |
| Calculated Molecular Weight | 355 aa, 37 kDa |
| Observed Molecular Weight | 20-22 kDa |
| GenBank Accession Number | BC041168 |
| Gene Symbol | LCN12 |
| Gene ID (NCBI) | 286256 |
| RRID | AB_3742271 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q6JVE5 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| WB protocol for LCN12 antibody 28004-1-AP | Download protocol |
| Citations | - |
| Dilutions | WB : 1:1000-1:8000 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
LCN12 (Lipocalin 12) is an epididymis-specific protein that might play a significant physiological role in male reproduction (PMID: 20692383). Protocols Product Specific Protocols WB protocol for LCN12 antibody 28004-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
