LILRA4 Polyclonal antibody 21153-1-AP proteintech
$149.00
In stock
SKU
21153-1-AP
| Catalog Number | 21153-1-AP |
| Synonyms | CD85g, CD85 antigen-like family member G, ILT 7, ILT7, ILT-7 |
| Host | Rabbit |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IF/ICC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | mouse spleen tissue, HL-60 cells, L02 cells |
| Tested Applications — Positive IF/ICC detected in | HL-60 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:1000 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Positive WB detected in | mouse spleen tissue, HL-60 cells, L02 cells |
| Positive IF/ICC detected in | HL-60 cells |
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Tested Reactivity | human, mouse |
| Cited Reactivity | human |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag15721 Product name: Recombinant human LILRA4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 66-153 aa of BC109198 Sequence: VVTSGVNVTLRCASRLGLGRFTLIEEGDHRLSWTLNSHQHNHGKFQALFPMGPLTFSNRGTFRCYGYENNTPYVWSEPSDPLQLLVSG Predict reactive species |
| Full Name | leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 4 |
| Calculated Molecular Weight | 499 aa, 55 kDa |
| Observed Molecular Weight | 48-55 kDa |
| GenBank Accession Number | BC109198 |
| Gene Symbol | LILRA4 |
| Gene ID (NCBI) | 23547 |
| RRID | AB_10755291 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P59901 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for LILRA4 antibody 21153-1-AP | Download protocol |
| WB protocol for LILRA4 antibody 21153-1-AP | Download protocol |
| human | WB Cell Rep IFNα-induced BST2+ tumor-associated macrophages facilitate immunosuppression and tumor growth in pancreatic cancer by ERK-CXCL7 signaling Authors - Chenlei Zheng View Article |
| Citations | 1 |
| Dilutions | WB : 1:500-1:1000 IF/ICC : 1:200-1:800 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Publications
- IFNα-induced BST2+ tumor-associated macrophages facilitate immunosuppression and tumor growth in pancreatic cancer by ERK-CXCL7 signaling
Journal: Cell Rep | Authors: Chenlei Zheng | Species: human | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
