Mmp9 Recombinant monoclonal antibody 82854-8-RR proteintech
$149.00
In stock
SKU
82854-8-RR
| Catalog Number | 82854-8-RR |
| Synonyms | 230069G7, AW743869, B/MMP9, Clg4b, matrix metallopeptidase 9 |
| Host | Rabbit |
| Reactivity | mouse and More (1) |
| Reactivity | mouse, human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | mouse spleen tissue, mouse lung tissue |
| Tested Applications — Positive IHC detected in | mouse spleen tissue, mouse lung tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | LPS and Brefeldin A treated RAW 264.7 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:5000-1:50000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:250-1:1000 |
| Positive WB detected in | mouse spleen tissue, mouse lung tissue |
| Positive IHC detected in | mouse spleen tissue, mouse lung tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | LPS and Brefeldin A treated RAW 264.7 cells |
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:250-1:1000 |
| Tested Reactivity | mouse |
| Cited Reactivity | human, mouse |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Eg0452 Product name: Recombinant Mouse MMP-9 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 20-730 aa of NM_013599 Sequence: APYQRQPTFVVFPKDLKTSNLTDTQLAEAYLYRYGYTRAAQMMGEKQSLRPALLMLQKQLSLPQTGELDSQTLKAIRTPRCGVPDVGRFQTFKGLKWDHHNITYWIQNYSEDLPRDMIDDAFARAFAVWGEVAPLTFTRVYGPEADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGAGVQGDAHFDDDELWSLGKGVVIPTYYGNSNGAPCHFPFTFEGRSYSACTTDGRNDGTPWCSTTADYDKDGKFGFCPSERLYTEHGNGEGKPCVFPFIFEGRSYSACTTKGRSDGYRWCATTANYDQDKLYGFCPTRVDATVVGGNSAGELCVFPFVFLGKQYSSCTSDGRRDGRLWCATTSNFDTDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPLYSYLEGFPLNKDDIDGIQYLYGRGSKPDPRPPATTTTEPQPTAPPTMCPTIPPTAYPTVGPTVGPTGAPSPGPTSSPSPGPTGAPSPGPTAPPTAGSSEASTESLSPADNPCNVDVFDAIAEIQGALHFFKDGWYWKFLNHRGSPLQGPFLTARTWPALPATLDSAFEDPQTKRVFFFSGRQMWVYTGKTVLGPRSLDKLGLGPEVTHVSGLLPRRLGKALLFSKGRVWRFDLKSQKVDPQSVIRVDKEFSGVPWNSHDIFQYQDKAYFCHGKFFWRVSFQNEVNKVDHEVNQVDDVGYVTYDLLQCP Predict reactive species |
| Full Name | matrix metallopeptidase 9 |
| Calculated Molecular Weight | 81kd |
| Observed Molecular Weight | 92-100 kDa |
| GenBank Accession Number | NM_013599 |
| Gene Symbol | Mmp9 |
| Gene ID (NCBI) | 17395 |
| RRID | AB_3670580 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P41245-1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for Mmp9 antibody 82854-8-RR | Download protocol |
| IHC protocol for Mmp9 antibody 82854-8-RR | Download protocol |
| WB protocol for Mmp9 antibody 82854-8-RR | Download protocol |
| mouse | WB J Orthop Translat Txnip regulates glycolysis and tricarboxylic acid cycle balance to maintain bone homeostasis. Authors - Xiankun Cao KO Validated View Article |
| human | WB Animal Model Exp Med Long noncoding RNA GCH1 mediates mitophagy via the PTEN-induced kinase 1/Parkin pathway to drive chondrocyte dysfunction and cartilage degeneration in osteoarthritis Authors - Gang Zeng View Article |
| Citations | 13 |
| Dilutions | WB : 1:5000-1:50000 IHC : 1:500-1:2000 IF/ICC : 1:250-1:1000 |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 230069G7 |
| Conjugation | Unconjugated |
Mmp9 (matrix metallopeptidase 9), also known as Clg4b. It is expected to be located inextracellular matrix. Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, tissue remodeling, and disease processes, such as arthritis or metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. Studies in rhesus monkeys suggest that MMP9 is involved in IL-8-induced mobilization hematopoietic progenitor cells from bone marrow, and murine studies suggest a role in tumor-associated tissue remodeling. The pro-MMP9 is 92 kDa, and it can be detected a processed form of 68 kDa. This protein can exist as a dimer of 180 kDa (PMID:7492685). Protocols Product Specific Protocols IF protocol for Mmp9 antibody 82854-8-RR Download protocol IHC protocol for Mmp9 antibody 82854-8-RR Download protocol WB protocol for Mmp9 antibody 82854-8-RR Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Engineered T cell membrane coated nanoparticles reverse thermo-resistance and reprogram tumor microenvironment to synergistically potentiate bladder cancer photothermal immunotherapy.
Journal: J Nanobiotechnology | Authors: Zichen Zhong | Species: mouse | Application: WB - Long noncoding RNA GCH1 mediates mitophagy via the PTEN-induced kinase 1/Parkin pathway to drive chondrocyte dysfunction and cartilage degeneration in osteoarthritis
Journal: Animal Model Exp Med | Authors: Gang Zeng | Species: human | Application: WB - Bee sting acupuncture mitigates osteoarthritis in male mice via PPAR-γ activation: integrated network pharmacology, transcriptomics, and experimental validation.
Journal: Int Immunopharmacol | Authors: Zhiyuan Feng | Species: mouse | Application: WB - Peptide-Enhanced Bioactive Hydrogel Combined with Photodynamic-Phage Synergistic Antibacterial Therapy System Accelerates Infected Wound Healing
Journal: Adv Healthc Mater | Authors: Liang Quan | Species: mouse | Application: IHC - Microcystin-LR Impairs Endometrial Receptivity during the Peri-Implantation Window via Disruption of STAT3/HIF-1α Signaling.
Journal: Environ Health (Wash) | Authors: Yao Guo | Species: mouse | Application: WB - Txnip regulates glycolysis and tricarboxylic acid cycle balance to maintain bone homeostasis.
Journal: J Orthop Translat | Authors: Xiankun Cao KO Validated | Species: mouse | Application: WB - Bee sting acupuncture mitigates osteoarthritis in male mice via PPAR-γ activation: integrated network pharmacology, transcriptomics, and experimental validation.
Journal: Int Immunopharmacol | Authors: Zhiyuan Feng | Species: mouse | Application: WB - Anti-glioma mechanism of Angelica sinensis and stigmasterol: p53-associated ferroptosis identified via multi-method analysis.
Journal: Sci Rep | Authors: XueJiao Jiang - KLF2 interacts with AP-1 to negatively affect osteoclast differentiation and activity.
Journal: Cell Signal | Authors: Sijun Liu - Long noncoding RNA GCH1 mediates mitophagy via the PTEN-induced kinase 1/Parkin pathway to drive chondrocyte dysfunction and cartilage degeneration in osteoarthritis
Journal: Animal Model Exp Med | Authors: Gang Zeng | Species: human | Application: WB - A SASP-related four-gene signature associated with intervertebral disc degeneration: integrated bioinformatics analysis and validation of pinocembrin as a therapeutic candidate.
Journal: Mol Biol Rep | Authors: Ge-Liang Yao | Species: mouse | Application: WB - Usefulness of serial in vivo imaging to directly assess the role of inflammation in thrombus resolution and organization
Journal: Biochem Biophys Res Commun | Authors: Aditya Adinata | Species: mouse | Application: IHC - PRSS1 promotes gastric cancer invasion and metastasis by induction of the epithelial-mesenchymal transition and activation of the MAPK/ERK pathway.
Journal: Transl Cancer Res | Authors: Xiang Bai | Species: human | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
