LYPD6B Polyclonal antibody 25508-1-AP proteintech
$149.00
In stock
SKU
25508-1-AP
| Catalog Number | 25508-1-AP |
| Synonyms | CT116, Ly6/PLAUR domain-containing protein 6B, LYPD7 |
| Host | Rabbit |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive IHC detected in | mouse lung tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Positive IHC detected in | mouse lung tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Tested Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag22008 Product name: Recombinant human LYPD6B protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-83 aa of BC040176 Sequence: MLLITLSANLFTVPERSLTTTFSFSRYKSSDRPAHKVSMLLLCHALAIAVVQIVIFSESWAFAKNINFYNVRPPLDPTPFPNS Predict reactive species |
| Full Name | LY6/PLAUR domain containing 6B |
| Calculated Molecular Weight | 183 aa, 20 kDa |
| GenBank Accession Number | BC040176 |
| Gene Symbol | LYPD6B |
| Gene ID (NCBI) | 130576 |
| RRID | AB_3742150 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8NI32 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for LYPD6B antibody 25508-1-AP | Download protocol |
| Citations | - |
| Dilutions | IHC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
LYPD6B (containing the Ly6/PLAUR domain protein 6B), also known as LYPD7, is a member of the Ly6/uPAR superfamily of proteins. These proteins typically exhibit membrane-anchoring properties and participate in critical cellular signaling and adhesion processes. It is predominantly expressed in the central nervous system. LYPD6B functions as a key regulatory subunit that interacts with and modulates nicotinic acetylcholine receptors (nAChRs), specifically influencing their maturation, stability, and functional properties at synapses. This interaction is crucial for normal cholinergic signaling, which underpins cognitive functions such as learning and memory. Dysfunction of the LYPD6B is associated with multiple neurological disorders. (PMID: 23186997, PMID: 34631692, PMID: 39433742) Protocols Product Specific Protocols IHC protocol for LYPD6B antibody 25508-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
