LYRM2 Polyclonal antibody 31674-1-AP proteintech
$149.00
In stock
SKU
31674-1-AP
| Catalog Number | 31674-1-AP |
| Synonyms | LYR motif containing 2 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive IP detected in | HT-29 cells, COLO 320 cells |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Positive IP detected in | HT-29 cells, COLO 320 cells |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Tested Reactivity | human |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag36366 Product name: Recombinant human LYRM2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 20-88 aa of BC009782 Sequence: QQVLLLYRRILQTIRQVPNDSDRKYLKDWAREEFRRNKSATEEDTIRMMITQGNMQLKELEKTLALAKS Predict reactive species |
| Full Name | LYR motif containing 2 |
| Observed Molecular Weight | 10 kDa |
| GenBank Accession Number | BC009782 |
| Gene Symbol | LYRM2 |
| Gene ID (NCBI) | 57226 |
| RRID | AB_3742461 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q9NU23 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IP protocol for LYRM2 antibody 31674-1-AP | Download protocol |
| Citations | - |
| Dilutions | IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
LYR motif containing 2 (LYRM2) is an evolutionarily conserved gene which belongs to LYR (leucine-tyrosine-arginine) motif proteins (LYRMs) family. LYRM2 is the one of the top ten most significantly upregulated differentially expressed genes in trabecular osteocytes between osteoporosis and normal controls (PMID: 34252604), which is up-regulated in colorectal cancer and promotes tumor growth both in vivo and in vitro. LYRM2 locates in the mitochondrial inner membrane and matrix (PMID: 31004700). Protocols Product Specific Protocols IP protocol for LYRM2 antibody 31674-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
