LC3 Monoclonal antibody 66139-3-Ig proteintech
$149.00
In stock
SKU
66139-3-Ig
| Catalog Number | 66139-3-Ig |
| Synonyms | MAP1LC3A, Autophagy-related protein LC3 A, Autophagy-related ubiquitin-like modifier LC3 A, LC3A, MAP1 light chain 3-like protein 1 |
| Host | Mouse |
| Reactivity | human, mouse, rat and More (1) |
| Reactivity | human, mouse, rat, sheep |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IF/ICC, ELISA |
| Applications | IF/ICC, ELISA |
| Host / Isotype | Mouse / IgG1 |
| Tested Applications — Positive IF/ICC detected in | Chloroquine treated NIH/3T3 cells, Chloroquine treated HeLa cells, Chloroquine treated PC-12 cells |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:250-1:1000 |
| Positive IF/ICC detected in | Chloroquine treated NIH/3T3 cells, Chloroquine treated HeLa cells, Chloroquine treated PC-12 cells |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:250-1:1000 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, sheep |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag17959 Product name: Recombinant human MAP1LC3A,LC3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-121 aa of BC015810 Sequence: MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGF Predict reactive species |
| Full Name | microtubule-associated protein 1 light chain 3 alpha |
| Calculated Molecular Weight | 121 aa, 14 kDa |
| GenBank Accession Number | BC015810 |
| Gene Symbol | LC3 |
| Gene ID (NCBI) | 84557 |
| RRID | AB_3741513 |
| Conjugate | Unconjugated |
| Purification Method | Protein G purification |
| UNIPROT ID | Q9H492 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for LC3 antibody 66139-3-Ig | Download protocol |
| mouse | IF Commun Biol Glycine alleviates ovarian granulosa cell ferroptosis induced by ERα-mediated internalization of polystyrene microplastics. Authors - Guangyu Liu View Article |
| human | IF Front Immunol Comprehensive analysis of IGFL1 in colorectal cancer and its promotion of tumour progression via inhibition of lipophagy. Authors - Ao Wang View Article |
| Citations | 11 |
| Dilutions | IF/ICC : 1:250-1:1000 |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Clone Number | 2A5E4 |
| Conjugation | Unconjugated |
LC3A, also named as MAP1LC3A, LC3, MAP1ALC3 and MAP1BLC3, belongs to the MAP1 LC3 family. LC3A is one of the light chain subunits and can associate with either MAP1A or MAP1B, which are microtubule-associated proteins that mediate the physical interactions between microtubules and components of the cytoskeleton. In cell biology, autophagy, or autophagocytosis, is a catabolic process involving the degradation of a cell's components through the lysosomalmachinery. It is a major mechanism by which a starving cell reallocates nutrients from unnecessary processes to more-essential processes. Two forms of LC3, called LC3-I (17-19kd) and -II(14-16kd), were produced post-translationally in various cells. LC3-I is cytosolic, whereas LC3-II is membrane bound. The precursor molecule is cleaved by APG4B/ATG4B to form the cytosolic form, LC3-I. This is activated by APG7L/ATG7, transferred to ATG3 and conjugated to phospholipid to form the membrane-bound form, LC3-II. The amount of LC3-II is correlated with the extent of autophagosome formation. LC3-II is the first mammalian protein identified that specifically associates with autophagosome membranes. (PMID:11060023) MAP1LC3 has 3 isoforms MAP1LC3A, MAP1LC3B and MAP1LC3C. MAP1LC3A and MAP1LC3C are produced by the proteolytic cleavage after the conserved C-terminal Gly residue, like their rat counterpart, MAP1LC3B does not undergo C-terminal cleavage and exists in a single modified form.(PMID:12740394 ) Protocols Product Specific Protocols IF protocol for LC3 antibody 66139-3-Ig Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- The SDF-1α/CXCR4 axis regulates chondrocyte mitochondrial dynamics via the ERK/AMPKα pathway.
Journal: Cell Commun Signal | Authors: Jiazhou Li | Species: mouse | Application: IF - Naringenin from Citrus aurantium L. alleviates loperamide-induced constipation by inhibiting excessive autophagy-mediated apoptosis in interstitial cells of Cajal via the AKT1 signaling pathway.
Journal: Int J Biol Macromol | Authors: Renjing Lin | Species: mouse | Application: IF - Polystyrene microplastics disrupt the blood-testis barrier via CEBPB-driven lysosomal autophagy and induce ferroptosis-like injury in human sperm, compromising embryo development.
Journal: J Hazard Mater | Authors: Man Wu | Species: human | Application: WB - Comprehensive analysis of IGFL1 in colorectal cancer and its promotion of tumour progression via inhibition of lipophagy.
Journal: Front Immunol | Authors: Ao Wang | Species: human | Application: IF - Deletion of SH2D5 alleviates epileptic seizures and NMDAR expression via autophagic degradation of STAT1.
Journal: JCI Insight | Authors: Haokun Guo KO Validated | Species: mouse | Application: IF - Glycine alleviates ovarian granulosa cell ferroptosis induced by ERα-mediated internalization of polystyrene microplastics.
Journal: Commun Biol | Authors: Guangyu Liu | Species: mouse | Application: IF
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
