JNK Polyclonal antibody 28007-1-AP proteintech
$149.00
In stock
SKU
28007-1-AP
| Catalog Number | 28007-1-AP |
| Synonyms | c Jun N terminal kinase 3, FLJ12099, FLJ33785, JNK, JNK1, JNK1/2/3, JNK2, JNK3, JNK3A, MAP kinase 10, MAP kinase p49 3F12, MAPK 10, MAPK10, MAPK8, MAPK8/9/10, MAPK9, p493F12, p54bSAPK, PRKM10 |
| Host | Rabbit |
| Reactivity | Human, Mouse, canine and More (3) |
| Reactivity | human, mouse, canine, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF, ELISA |
| Applications | WB, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | Neuro-2a cells, MDCK cells, mouse brain tissue, mouse cerebellum tissue |
| Tested Applications — Positive IHC detected in | mouse brain tissue, mouse cerebellum tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:4000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Positive WB detected in | Neuro-2a cells, MDCK cells, mouse brain tissue, mouse cerebellum tissue |
| Positive IHC detected in | mouse brain tissue, mouse cerebellum tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Tested Reactivity | Human, Mouse, canine |
| Cited Reactivity | human, mouse, rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag27823 Product name: Recombinant human MAPK10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 271-408 aa of BC065516 Sequence: QWNKVIEQLGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNG Predict reactive species |
| Full Name | mitogen-activated protein kinase 10 |
| Calculated Molecular Weight | 464 aa, 53 kDa |
| Observed Molecular Weight | 45-48 kDa, 54-57 kDa |
| GenBank Accession Number | BC065516 |
| Gene Symbol | JNK3 |
| Gene ID (NCBI) | 5602 |
| RRID | AB_2881035 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P53779 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for JNK antibody 28007-1-AP | Download protocol |
| WB protocol for JNK antibody 28007-1-AP | Download protocol |
| rat | WB,IHC Clin Sci (Lond) Transcriptome-based exploration of potential molecular targets and mechanisms of selenomethionine in alleviating renal ischemia-reperfusion injury. Authors - Jun Pei View Article |
| mouse | WB Int J Biol Macromol VSIG4 inhibits RANKL-induced osteoclastogenesis by enhancing Nrf2-dependent antioxidant response against reactive oxygen species production Authors - Jiansen Miao View Article |
| human | WB Nat Commun SARS-CoV-2 N protein-induced Dicer, XPO5, SRSF3, and hnRNPA3 downregulation causes pneumonia Authors - Yu-Wei Luo View Article |
| Citations | 8 |
| Dilutions | WB : 1:1000-1:4000 IHC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
JNK, also named MAPK10 (mitogen-activated protein kinase 10), belongs to MAP kinase family. MAP kinases act as integration points for multiple biochemical signals, and thus are involved in a wide variety of cellular processes, such as proliferation, differentiation, transcription regulation and development. This kinase is mainly expressed in a subset of neurons in the nervous system, and is activated by threonine and tyrosine phosphorylation. JNK has 3 isoforms of 48-53 kDa. Protocols Product Specific Protocols IHC protocol for JNK antibody 28007-1-AP Download protocol WB protocol for JNK antibody 28007-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Exploring potential targets and mechanisms of renal tissue damage caused by N-(1,3-dimethylbutyl)-N'-phenyl-p-phenylenediamine quinone (6-PPDQ) through network toxicology and animal experiments: A case of chronic kidney disease
Journal: Sci Total Environ | Authors: Jun Pei | Species: rat | Application: WB - VSIG4 inhibits RANKL-induced osteoclastogenesis by enhancing Nrf2-dependent antioxidant response against reactive oxygen species production
Journal: Int J Biol Macromol | Authors: Jiansen Miao | Species: mouse | Application: WB - Selenoprotein GPX3 regulates NADPH oxidase expression by inhibiting the MAPK signaling pathway and thereby attenuating the inflammatory response in renal ischemia-reperfusion injury.
Journal: Genes Dis | Authors: Jun Pei | Species: rat | Application: WB,IHC,IF - Identification of ALDH2 as a novel target for the treatment of acute kidney injury in kidney transplantation based on WGCNA and machine learning algorithms and exploration of its potential mechanism of action using animal experiments
Journal: Front Immunol | Authors: Jinpu Peng | Species: rat | Application: WB - SARS-CoV-2 N protein-induced Dicer, XPO5, SRSF3, and hnRNPA3 downregulation causes pneumonia
Journal: Nat Commun | Authors: Yu-Wei Luo | Species: human | Application: WB - Transcriptome-based exploration of potential molecular targets and mechanisms of selenomethionine in alleviating renal ischemia-reperfusion injury.
Journal: Clin Sci (Lond) | Authors: Jun Pei | Species: rat | Application: WB,IHC - Identification of ALDH2 as a novel target for the treatment of acute kidney injury in kidney transplantation based on WGCNA and machine learning algorithms and exploration of its potential mechanism of action using animal experiments
Journal: Front Immunol | Authors: Jinpu Peng | Species: rat | Application: WB - Molecular mechanisms and potential targets of lycopene for alleviating renal ischemia-reperfusion injury revealed by network pharmacology and animal experiments
Journal: Int Immunopharmacol | Authors: Xingyu Pan | Species: human | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
