MAPKSP1 Polyclonal antibody 11937-1-AP proteintech
$149.00
In stock
SKU
11937-1-AP
| Catalog Number | 11937-1-AP |
| Synonyms | LAMTOR3, MAP2K1IP1, MAPBP, MAPK scaffold protein 1, MAPKSP1, MEK binding partner 1, MP1 |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | human liver tissue, L02 cells, mouse brain tissue, mouse liver tissue |
| Tested Applications — Positive IHC detected in | human prostate cancer tissue, human heart tissue, human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:2000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Positive WB detected in | human liver tissue, L02 cells, mouse brain tissue, mouse liver tissue |
| Positive IHC detected in | human prostate cancer tissue, human heart tissue, human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag2534 Product name: Recombinant human MAPKSP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-124 aa of BC026245 Sequence: MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELRQVVEVS Predict reactive species |
| Full Name | MAPK scaffold protein 1 |
| Calculated Molecular Weight | 124 aa, 14 kDa |
| Observed Molecular Weight | 14 kDa |
| GenBank Accession Number | BC026245 |
| Gene Symbol | MAPKSP1 |
| Gene ID (NCBI) | 8649 |
| RRID | AB_2141610 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UHA4 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for MAPKSP1 antibody 11937-1-AP | Download protocol |
| WB protocol for MAPKSP1 antibody 11937-1-AP | Download protocol |
| human | WB EMBO J Micropeptide hSPAR regulates glutamine levels and suppresses mammary tumor growth via a TRIM21-P27KIP1-mTOR axis Authors - Yan Huang View Article |
| Citations | 2 |
| Dilutions | WB : 1:500-1:2000 IHC : 1:20-1:200 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
MAPKSP1, also named as mitogen activated protein kinase kinase 1 interacting protein 1, Map2k1ip1, MEK partner 1, Lamtor3 and MP1. It was first identified as a scaffold protein enhancing the efficiency of the MAPK pathway by facilitating the interaction between MEK1 and ERK1 upon serum stimulation (PMID: 9733512). Later, it has been demonstrated that MAPKSP1 enhances activation of both ERK1 and ERK2 as a response to EGF (PMID: 12479806) and fibronectin (PMID: 15923628). MAPKSP1 is involved in regulating endosomal signaling (PMID: 17178906), and a role in cancer, via MEK and ERK hyperactivation, has been demostrated in pancreatic tumorigenesis (PMID: 24209743). MAPKSP1 has two isoforms with the molecular weight of 13-14 kDa. Protocols Product Specific Protocols IHC protocol for MAPKSP1 antibody 11937-1-AP Download protocol WB protocol for MAPKSP1 antibody 11937-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Brucea javanica Oil Emulsion Promotes Autophagy in Ovarian Cancer Cells Through the miR-8485/LAMTOR3/mTOR/ATG13 Signaling Axis
Journal: Front Pharmacol | Authors: Yihan Wang | Species: human | Application: WB - Micropeptide hSPAR regulates glutamine levels and suppresses mammary tumor growth via a TRIM21-P27KIP1-mTOR axis
Journal: EMBO J | Authors: Yan Huang | Species: human | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
