MDC1 Polyclonal antibody 24721-1-AP proteintech
$149.00
In stock
SKU
24721-1-AP
| Catalog Number | 24721-1-AP |
| Synonyms | MDC 1, NFBD 1, NFBD1 |
| Host | Rabbit |
| Reactivity | human and More (1) |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HeLa cells |
| Tested Applications — Positive IHC detected in | mouse testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HEK-293 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:2000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:500-1:2000 |
| Positive WB detected in | HeLa cells |
| Positive IHC detected in | mouse testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HEK-293 cells |
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:500-1:2000 |
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag20135 Product name: Recombinant human MDC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC152556 Sequence: MEDTQAIDWDVEEEEETEQSSESLRCNVEPVGRLHIFSGAHGPEKDFPLHLGKNVVGRMPDCSVALPFPSISKQHAEIEILAWDKAPILRDCGSLNGTQILRPPKVLSPGVSHRLRDQELILFADLLCQYHRLDVSLPFVSRGPLTVEETPRVQGETQPQRLLLAEDSEEEVDFLSERRMVKKSRTTSSSVIVPESDEEGHSPVLGGLGPPFAFNLNSDTDVEEGQQPATEEASSAARRGATVEAKQSEAEVVTEIQLEKDQPLVKERDNDTKVKRGAGNGVVPAGVILERSQPPGEDSDTDVDDDSRPPGRPAEVHLERAQPFGFIDSDTDAEEERIPATPVVIPMKKR Predict reactive species |
| Full Name | mediator of DNA damage checkpoint 1 |
| Calculated Molecular Weight | 2089 aa, 227 kDa |
| GenBank Accession Number | BC152556 |
| Gene Symbol | MDC1 |
| Gene ID (NCBI) | 9656 |
| RRID | AB_2879688 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q14676 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for MDC1 antibody 24721-1-AP | Download protocol |
| IHC protocol for MDC1 antibody 24721-1-AP | Download protocol |
| WB protocol for MDC1 antibody 24721-1-AP | Download protocol |
| human | WB Sci Adv VGLL3 modulates chemosensitivity through promoting DNA double-strand break repair Authors - Wei Wu View Article |
| mouse | IF Cell Rep The male pachynema-specific protein MAPS drives phase separation in vitro and regulates sex body formation and chromatin behaviors in vivo Authors - Zexiong Lin View Article |
| Citations | 13 |
| Dilutions | WB : 1:500-1:2000 IHC : 1:50-1:500 IF/ICC : 1:500-1:2000 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
MDC1, also named as KIAA0170 or NFBD1, is a 2089 amino acid protein, which contains two BRCT domains and one FHA domain. MDC1 localizes in the nucleus and is highly expressed in testis. MDC1 is required for checkpoint mediated cell cycle arrest in response to DNA damage within both the S phase and G2/M phases of the cell cycle. MDC1 may serve as a scaffold for the recruitment of DNA repair and signal transduction proteins to discrete foci of DNA damage marked. Protocols Product Specific Protocols IF protocol for MDC1 antibody 24721-1-AP Download protocol IHC protocol for MDC1 antibody 24721-1-AP Download protocol WB protocol for MDC1 antibody 24721-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- A PARylation-phosphorylation cascade promotes TOPBP1 loading and RPA-RAD51 exchange in homologous recombination.
Journal: Mol Cell | Authors: Jiao Zhao | Species: human | Application: WB - Topoisomerase I Inhibition in ETV4-overexpressed Non-Small Cell Lung Cancer Promotes Replication and Transcription Mediated R-Loop Accumulation and DNA Damage
Journal: Adv Sci (Weinh) | Authors: Jiaxi Zhang | Species: human | Application: IF - Wnt signaling induces radioresistance through upregulating HMGB1 in esophageal squamous cell carcinoma.
Journal: Cell Death Dis | Authors: Yuanyuan Zhao | Species: mouse | Application: IF - SFN Enhanced the Radiosensitivity of Cervical Cancer Cells via Activating LATS2 and Blocking Rad51/MDC1 Recruitment to DNA Damage Site.
Journal: Cancers (Basel) | Authors: Shiyu Wang | Species: human | Application: IF - VGLL3 modulates chemosensitivity through promoting DNA double-strand break repair
Journal: Sci Adv | Authors: Wei Wu | Species: human | Application: WB - The male pachynema-specific protein MAPS drives phase separation in vitro and regulates sex body formation and chromatin behaviors in vivo
Journal: Cell Rep | Authors: Zexiong Lin | Species: mouse | Application: IF
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
