MFAP5 Polyclonal antibody 15727-1-AP proteintech
$149.00
In stock
SKU
15727-1-AP
| Catalog Number | 15727-1-AP |
| Synonyms | MAGP 2, MAGP2, MAGP-2, MFAP 5, MFAP-5 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF, ELISA |
| Applications | WB, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HeLa cells |
| Tested Applications — Positive IHC detected in | human colon tissue, human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:4000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:400-1:1600 |
| Positive WB detected in | HeLa cells |
| Positive IHC detected in | human colon tissue, human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:400-1:1600 |
| Tested Reactivity | human |
| Cited Reactivity | human |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag8467 Product name: Recombinant human MFAP5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 27-173 aa of BC005901 Sequence: NSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL Predict reactive species |
| Full Name | microfibrillar associated protein 5 |
| Calculated Molecular Weight | 173 aa, 20 kDa |
| Observed Molecular Weight | 20-25 kDa |
| GenBank Accession Number | BC005901 |
| Gene Symbol | MFAP5 |
| Gene ID (NCBI) | 8076 |
| RRID | AB_2266295 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13361 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for MFAP5 antibody 15727-1-AP | Download protocol |
| WB protocol for MFAP5 antibody 15727-1-AP | Download protocol |
| human | WB Clin Transl Med Angiotensin receptor blockers retard the progression and fibrosis via inhibiting the viability of AGTR1+ CAFs in intrahepatic cholangiocarcinoma Authors - Jian-Hui Li View Article |
| Citations | 13 |
| Dilutions | WB : 1:1000-1:4000 IHC : 1:400-1:1600 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
MFAP5 (microfibrillar-associated protein 5), also known as MAGP2, is a secreted extracellular matrix protein with a predicted molecular weight of ~25.5 kDa (UniProt: Q13361). However, due to extensive post-translational modifications including glycosylation and disulfide bond formation, its apparent molecular weight on SDS-PAGE ranges from ~28 to 32 kDa. The protein contains a signal peptide (~1.8 kDa) and a central proline-rich region, contributing to its anomalous electrophoretic migration. MFAP5 functions in elastic fiber assembly and TGF-β signaling regulation, with elevated expression associated with tumor progression and poor prognosis in various cancers. Protocols Product Specific Protocols IHC protocol for MFAP5 antibody 15727-1-AP Download protocol WB protocol for MFAP5 antibody 15727-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- YAP promotes proliferation, chemoresistance and angiogenesis in human cholangiocarcinoma via TEAD transcription factors.
Journal: Hepatology | Authors: Patricia Marti KD Validated | Species: human | Application: WB,IHC - Single-cell transcriptomes reveal heterogeneity of high-grade serous ovarian carcinoma.
Journal: Clin Transl Med | Authors: Qian Hao | Species: human | Application: IHC - DPP6 and MFAP5 are associated with immune infiltration as diagnostic biomarkers in distinguishing uterine leiomyosarcoma from leiomyoma
Journal: Front Oncol | Authors: Yumin Ke | Species: human | Application: IHC - Development of a CAFs-related gene signature to predict survival and drug response in bladder cancer.
Journal: Hum Cell | Authors: Zhao Zhang | Species: human | Application: IHC - Stromal fibroblast-derived MFAP5 promotes the invasion and migration of breast cancer cells via Notch1/slug signaling.
Journal: Clin Transl Oncol | Authors: Z Chen KD Validated | Species: human | Application: WB - Angiotensin receptor blockers retard the progression and fibrosis via inhibiting the viability of AGTR1+ CAFs in intrahepatic cholangiocarcinoma
Journal: Clin Transl Med | Authors: Jian-Hui Li | Species: human | Application: WB - Key Molecules in Bladder Cancer Affect Patient Prognosis and Immunotherapy Efficacy: Further Exploration for CNTN1 and EMP1
Journal: JCO Precis Oncol | Authors: Tailai Zhou | Species: Human - MFAP5(+) synovial fibroblasts drive LOX upregulation to promote osteoarthritis progression.
Journal: iScience | Authors: Linzhu Wang - DPP6 and MFAP5 are associated with immune infiltration as diagnostic biomarkers in distinguishing uterine leiomyosarcoma from leiomyoma
Journal: Front Oncol | Authors: Yumin Ke | Species: human | Application: IHC - Development of a CAFs-related gene signature to predict survival and drug response in bladder cancer.
Journal: Hum Cell | Authors: Zhao Zhang | Species: human | Application: IHC - Stromal fibroblast-derived MFAP5 promotes the invasion and migration of breast cancer cells via Notch1/slug signaling.
Journal: Clin Transl Oncol | Authors: Z Chen | Species: human | Application: WB - Microfibril-Associated Protein 5 Contributes to the Elastic Fiber Abnormalities in Aged Skin
Journal: Biol Pharm Bull | Authors: Fumiaki Sato | Species: human | Application: WB - PHLDA2 promotes breast cancer metastasis by co-opting a developmental program for placental vascular remodeling.
Journal: bioRxiv | Authors: Paige V Halas | Species: human | Application: IF
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
