MFSD2 Polyclonal antibody 30555-1-AP proteintech
$149.00
In stock
SKU
30555-1-AP
| Catalog Number | 30555-1-AP |
| Synonyms | NLS1, MFSD2a, Major facilitator superfamily domain-containing protein 2A, HsMFSD2A, HMFN0656 |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IF, ELISA |
| Applications | WB, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | mouse brain tissue, rat brain tissue |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:1000 |
| Positive WB detected in | mouse brain tissue, rat brain tissue |
| Western Blot (WB) | WB : 1:500-1:1000 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag33064 Product name: Recombinant human MFSD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 170-219 aa of BC092414 Sequence: MFISTEQTERDSATAYRMTVEVLGTVLGTAIQGQIVGQADTPCFQDLNSS Predict reactive species |
| Full Name | major facilitator superfamily domain containing 2 |
| Calculated Molecular Weight | 543 aa, 60 kDa |
| Observed Molecular Weight | 55-60 kDa |
| GenBank Accession Number | BC092414 |
| Gene Symbol | MFSD2 |
| Gene ID (NCBI) | 84879 |
| RRID | AB_3086361 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8NA29 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| WB protocol for MFSD2 antibody 30555-1-AP | Download protocol |
| human | IF Mol Carcinog MFSD2A Overexpression Inhibits Hepatocellular Carcinoma Through TGF-β/Smad Signaling Authors - Chaowen Xiao View Article |
| mouse | WB J Food Sci High sn-2 DHA in Dietary Triglyceride Enhances Cognitive Performance of Mice. Authors - Qi Fang View Article |
| Citations | 3 |
| Dilutions | WB : 1:500-1:1000 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
MFSD2 is a transmembrane protein and sodium-dependent lysophosphatidylcholine transporter. MFSD2 is involved in the establishment of the blood-brain barrier and is required for brain growth and function. Protocols Product Specific Protocols WB protocol for MFSD2 antibody 30555-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- MFSD2A Overexpression Inhibits Hepatocellular Carcinoma Through TGF-β/Smad Signaling
Journal: Mol Carcinog | Authors: Chaowen Xiao | Species: human | Application: IF - Sound conditioning strategy promoting paracellular permeability of the blood-labyrinth-barrier benefits inner ear drug delivery
Journal: Bioeng Transl Med | Authors: Xueling Wang | Species: mouse | Application: WB - High sn-2 DHA in Dietary Triglyceride Enhances Cognitive Performance of Mice.
Journal: J Food Sci | Authors: Qi Fang | Species: mouse | Application: WB
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
