| Catalog Number | 27441-1-AP |
| Synonyms | CCL3, MIP 1 alpha/CCL3, MIP-1 alpha, MIP-1 Alpha/CCL3, C C motif chemokine 3 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IF/ICC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | THP-1 cells |
| Tested Applications — Positive IF/ICC detected in | PMA, LPS and Brefeldin A treated THP-1 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:2000 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Positive WB detected in | THP-1 cells |
| Positive IF/ICC detected in | PMA, LPS and Brefeldin A treated THP-1 cells |
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Tested Reactivity | human |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag26764 Product name: Recombinant human CCL3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-92 aa of BC071834 Sequence: SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA Predict reactive species |
| Full Name | chemokine (C-C motif) ligand 3 |
| Calculated Molecular Weight | 92 aa, 10 kDa |
| Observed Molecular Weight | 10 kDa |
| GenBank Accession Number | BC071834 |
| Gene Symbol | CCL3/MIP-1 alpha |
| Gene ID (NCBI) | 6348 |
| RRID | AB_3085961 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P10147 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for CCL3/MIP-1 alpha antibody 27441-1-AP | Download protocol |
| WB protocol for CCL3/MIP-1 alpha antibody 27441-1-AP | Download protocol |
| Citations | - |
| Dilutions | WB : 1:500-1:2000 IF/ICC : 1:200-1:800 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Chemokine (C-C motif) ligand 3 (CCL3), also known as MIP-1α, belongs to the family of chemokines. CCL3 has been found in the central nervous system and its cognate receptors, CCR1 and CCR5, have been reported to be expressed by astrocytes, microglia and neurons. CCL3 and its receptors, CCR1 and CCR5, also contribute to the development of bone disease in multiple myeloma by supporting tumor growth and regulating osteoclast differentiation. CCL3 is also associated with the regulation of cell growth, angiogenesis, and metastasis of different tumors such as melanoma, renal cell carcinoma, and colorectal cancer. Moreover, CCL3 enhances cell migration and metastasis by up-regulating matrix metalloproteinase-2 (MMP)-2 expression in chondrosarcoma cells. Protocols Product Specific Protocols IF protocol for CCL3/MIP-1 alpha antibody 27441-1-AP Download protocol WB protocol for CCL3/MIP-1 alpha antibody 27441-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols