Anti-Human DR5/CD262 Rabbit Recombinant Antibody 98273-1-RR proteintech
$124.00
In stock
SKU
98273-1-RR
| Catalog Number | 98273-1-RR |
| Synonyms | DR5, 242319H8, CD262, Death receptor 5, KILLER |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide |
| Applications | FC |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive FC detected in | human PBMCs |
| Positive FC detected in | human PBMCs |
| Flow Cytometry (FC) | FC : 0.25 ug per 10^6 cells in a 100 µl suspension |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Eg1648 Product name: Recombinant Human DR5 protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 56-182 aa of BC001281 Sequence: ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE Predict reactive species |
| Full Name | tumor necrosis factor receptor superfamily, member 10b |
| Calculated Molecular Weight | 48 kDa |
| GenBank Accession Number | BC001281 |
| Gene Symbol | DR5 |
| Gene ID (NCBI) | 8795 |
| RRID | AB_3745939 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purfication |
| UNIPROT ID | O14763 |
| Storage Buffer | PBS with 0.09% sodium azide, pH 7.3. |
| Storage Conditions | Store at 2 - 8°C. Stable for one year after shipment. |
| FC protocol for DR5/CD262 antibody 98273-1-RR | Download protocol |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 242319H8 |
| Conjugation | Unconjugated |
DR5, also known as CD262, TNFRSF10B, TRAILR2, TRICK2 and KILLER, is a widely expressed single-pass type I membrane protein belonging to the tumour necrosis factor receptor superfamily (TNFRSF). It is a receptor for TNF-related apoptosis-inducing ligand (TRAIL), which is a member of the tumor necrosis factor (TNF) family of cytokines and induces apoptosis in a wide variety of cells (PMID: 9311998). DR5 contains two extracellular cysteine-rich repeats, typical for TNF receptor (TNFR) family members, and a cytoplasmic death domain (DD), through which DR5 is capable to transmit the apoptotic signal (PMID: 9311998; 20531300). Protocols Product Specific Protocols FC protocol for DR5/CD262 antibody 98273-1-RR Download protocol Standard Protocols Click here to view our Standard Protocols
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
